Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

ZNF683 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP180186

 View more versions of this product

Catalog No. NBP180186


Add to cart

Description

Description

ZNF683 Polyclonal antibody specifically detects ZNF683 in Human, Equine, Guinea Pig samples. It is validated for Western Blot.
Specifications

Specifications

ZNF683
Unconjugated
PBS & 2% Sucrose. with 0.09% Sodium Azide
Affinity Purified
ZNF683
Synthetic peptide directed towards the N terminal of human ZNF683. Peptide sequence KEESAAQLGCCHRPMALGGTGGSLSPSLDFQLFRGDQVFSACRPLPDMVD.
54 kDa
100 ul
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Western Blot
Western Blot 1:1000
NP_775845
MGC33414, zinc finger protein 683
Rabbit
IgG
Immunogen affinity purified
RUO
Primary
257101
Equine, Guinea Pig, Human
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit