Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ZNF683 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$204.00 - $482.50
Specifications
Antigen | ZNF683 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP18018620
|
Novus Biologicals
NBP18018620UL |
20 μL |
Each for $204.00
|
|
|||||
NBP180186
|
Novus Biologicals
NBP180186 |
100 μL |
Each for $482.50
|
|
|||||
Description
ZNF683 Polyclonal specifically detects ZNF683 in Human samples. It is validated for Western Blot.Specifications
ZNF683 | |
Polyclonal | |
Rabbit | |
NP_775845 | |
ZNF683 | |
IgG | |
54 kDa |
Western Blot | |
Unconjugated | |
RUO | |
257101 | |
Synthetic peptide directed towards the N terminal of human ZNF683. Peptide sequence KEESAAQLGCCHRPMALGGTGGSLSPSLDFQLFRGDQVFSACRPLPDMVD. | |
Primary |
Spot an opportunity for improvement?
Provide Content Correction
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title