Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

ZNF706 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$106.19 - $320.71

Specifications

Antigen ZNF706
Dilution Western Blot 1.0 ug/ml, Immunohistochemistry
Applications Western Blot, Immunohistochemistry
Conjugate Unconjugated
Format Purified
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NB123283
View Documents
Novus Biologicals
NBP309191100UL
100 μg
Each for $320.71
Add to cart
 
NB123284
View Documents
Novus Biologicals
NBP30919125UL
25 μg
Each for $106.19
Add to cart
 
Description

Description

ZNF706 Polyclonal antibody specifically detects ZNF706 in Human samples. It is validated for Western Blot, Immunohistochemistry
Specifications

Specifications

ZNF706
Western Blot, Immunohistochemistry
Purified
RUO
PBS buffer, 2% sucrose
51123
Polyclonal
Affinity purified
Western Blot 1.0 ug/ml, Immunohistochemistry
Unconjugated
Rabbit
Human
HSPC038, PNAS-106, PNAS-113, zinc finger protein 706
The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF706 (NP_057180). Peptide sequence MARGQQKIQSQQKNAKKQAGQKKKQGHDQKAAAKAALIYTCTVCRTQMPD
Primary
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit