Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

ZNF765 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus BiologicalsSupplier Diversity Partner NBP191630

 View more versions of this product

Catalog No. NBP191630


Add to cart

Description

Description

ZNF765 Polyclonal antibody specifically detects ZNF765 in Human, Mouse, Rat, Porcine, Bovine, Canine, Equine, Rabbit, Zebrafish samples. It is validated for Western Blot.
Specifications

Specifications

ZNF765
Unconjugated
PBS and 2% Sucrose with 0.09% Sodium Azide
Affinity Purified
ZNF765
The immunogen for this antibody is ZNF765. Peptide sequence CHRRLHTGEKPYKCEECDKAFHFKSKLQIHRRIHTGEKPYKCNECGKTFS.
Immunogen affinity purified
RUO
Primary
91661
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Western Blot
Western Blot 1:1000
NP_001035275
zinc finger protein 765
Rabbit
IgG
100 ul
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Expected identity based on immunogen sequence: Human: 100%; Mouse: 92%; Sumatran orangutan: 90%; Green puffer: 90%; Crab-eating macaque: 90%; Largemouth bass: 90%; Tunicate: 90%; Mosquito: 90%; Body louse: 90%; Rat: 90%; Red flour beetle: 90%; Fruit fly: 90%; Western clawed frog: 90%; Zebrafish: 90%; White-tufted-ear marmoset: 90%; Bovine: 90%; Florida lancelet: 85%; Chicken: 84%; Canine: 84%; Yellowfever mosquito: 84%; African malaria mosquito: 83%; Xenopus: 78%.
Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit