Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ZNF778 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$482.50
Specifications
| Antigen | ZNF778 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Form | Purified |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP180195
|
Novus Biologicals
NBP180195 |
100 μL |
Each of 1 for $482.50
|
|
|||||
Description
ZNF778 Polyclonal specifically detects ZNF778 in Human samples. It is validated for Western Blot.Specifications
| ZNF778 | |
| Polyclonal | |
| Purified | |
| RUO | |
| NP_872337 | |
| 197320 | |
| Synthetic peptide directed towards the middle region of human FLJ31875. Peptide sequence AFTGLSGLSKHVQTDPGQKPYECKDCGKACGGFYLLNEHGKTHTREKPFA. | |
| Primary | |
| 49 kDa |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Human | |
| FLJ31875, MGC150573, zinc finger protein 778 | |
| ZNF778 | |
| IgG | |
| Protein A purified |
Spot an opportunity for improvement?
Provide Content Correction
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title