Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ZNF842 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | ZNF842 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP180202
|
Novus Biologicals
NBP180202 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
ZNF842 Polyclonal specifically detects ZNF842 in Human samples. It is validated for Western Blot.Specifications
| ZNF842 | |
| Polyclonal | |
| Rabbit | |
| ZNF842 zinc finger protein 842 | |
| ZNF799 | |
| IgG | |
| Affinity Purified | |
| 71 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| 90576 | |
| Synthetic peptide directed towards the middle region of human ZNF799. Peptide sequence AFPDYSSCLRHERTHTGKKPYTCKQCGKAFSASTSLRRHETTHTDEKPYA. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title