ZPBP2 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP157768

Catalog No. NBP157768

Description

ZPBP2 Polyclonal specifically detects ZPBP2 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: ZPBP2
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Alias: CAAX prenyl protease 1 homolog, EC 3.4.24.84, FACE1FLJ14968, FACE-1zinc metalloproteinase (STE24 homolog, yeast), Farnesylated proteins-converting enzyme 1, farnesylated-proteins converting enzyme 1, HGPS, Hutchinson-Gilford progeria syndrome, MADB, Prenyl protein-specific endoprotease 1, PRO1, Ste24p, STE24zinc metallopeptidase (STE24 homolog, yeast), zinc metallopeptidase (STE24 homolog, S. cerevisiae), Zinc metalloproteinase Ste24 homolog
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 124626
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Gene Symbols: ZPBP2
• Immunogen: Synthetic peptides corresponding to ZPBP2 (zona pellucida binding protein 2) The peptide sequence was selected from the middle region of ZPBP2)(50ug). Peptide sequence VRLDSCRPGFGKNERLHSNCASCCVVCSPATFSPDVNVTCQTCVSVLTYG.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Human: 100%; Guinea pig: 92%; Equine: 92%; Mouse: 92%; Pig: 92%; Rat: 92%; Canine: 84%.
• Target Species: Human, Mouse, Rat, Equine, Guinea Pig, Rabbit
• Isotype: IgG