Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ZRANB1/Trabid Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP309380100UL
Description
ZRANB1/Trabid Polyclonal specifically detects ZRANB1/Trabid in Human samples. It is validated for Western Blot.Specifications
ZRANB1/Trabid | |
Polyclonal | |
Western Blot 1.0 ug/ml | |
HRPE773, jacalin-like lectin domain containing 2, JCLN2, pancreatic adenocarcinoma upregulated factor, PAUF, PRO1567, zymogen granule protein 16 homolog B, zymogen granule protein 16 homolog B (rat) | |
The immunogen is a synthetic peptide directed towards the C terminal region of human ZRANB1/Trabid (NP_060050). Peptide sequence GAGANLNTDDDVTITFLPLVDSERKLLHVHFLSAQELGNEEQQEKLLREW | |
100 μg | |
Cancer, DNA Repair, DNA replication Transcription Translation and Splicing | |
54764 | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS buffer, 2% sucrose | |
Rabbit | |
Affinity purified | |
RUO | |
Primary | |
Human | |
Purified |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction