Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

ZSCAN1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP18043720UL

 View more versions of this product

Catalog No. NBP18043720


Add to cart

Description

Description

ZSCAN1 Polyclonal antibody specifically detects Antigen in Human samples. It is validated for Western Blotting.
Specifications

Specifications

ZSCAN1
Unconjugated
PBS & 2% Sucrose. with No Preservative
Affinity Purified
ZSCAN1
Synthetic peptide directed towards the middle region of human ZSCAN1. Peptide sequence PECGKVFLHNSVLTEHGKIHLLEPPRKKAPRSKGPRESVPPRDGAQGPVA.
Immunogen affinity purified
RUO
Primary
284312
Western Blot
Western Blot 1:1000
NP_872378
FLJ33779, MGC104472, MZF-1, zinc finger and SCAN domain containing 1, zinc finger and SCAN domain-containing protein 1, zinc finger with SCAN domain 1, ZNF915
Rabbit
IgG
20ul
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Human
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit