Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ZUFSP Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$175.82 - $436.00
Specifications
Antigen | ZUFSP |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP18039720
|
Novus Biologicals
NBP18039720UL |
20 μL |
Each for $175.82
|
|
NBP180397
|
Novus Biologicals
NBP180397 |
100 μL |
Each for $436.00
|
|
Description
ZUFSP Polyclonal specifically detects ZUFSP in Human samples. It is validated for Western Blot.Specifications
ZUFSP | |
Polyclonal | |
Rabbit | |
NP_659499 | |
221302 | |
Synthetic peptide directed towards the C terminal of human C6orf113. Peptide sequence LCLLILDPGCPSREMQKLLKQDIEASSLKQLRKSMGNLKHKQYQILAVEG. | |
Primary | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
RUO | |
C6orf113, chromosome 6 open reading frame 113, dJ412I7.3, zinc finger with UFM1-specific peptidase domain, zinc finger with UFM1-specific peptidase domain protein | |
ZUFSP | |
IgG | |
Affinity Purified |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title