Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ZXDC Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$204.00 - $482.50
Specifications
| Antigen | ZXDC |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP17936820
|
Novus Biologicals
NBP17936820UL |
20 μL |
Each for $204.00
|
|
|||||
|
NBP179368
|
Novus Biologicals
NBP179368 |
100 μL |
Each for $482.50
|
|
|||||
Description
ZXDC Polyclonal specifically detects ZXDC in Human samples. It is validated for Western Blot.Specifications
| ZXDC | |
| Polyclonal | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| dJ337O18.5, SWIM domain containing 1, zinc finger, SWIM-type containing 1 | |
| ZXDC | |
| IgG |
| Western Blot | |
| Unconjugated | |
| RUO | |
| NP_001035743 | |
| 79364 | |
| Synthetic peptide directed towards the middle region of human ZXDCThe immunogen for this antibody is ZXDC. Peptide sequence NLKAHMKGHEQESLFKCEVCAERFPTHAKLSSHQRSHFEPERPYKCDFPG. | |
| Primary |
Spot an opportunity for improvement?
Provide Content Correction
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title