Recombinant Proteins
- (285)
- (11)
- (66,390)
- (1)
- (2)
- (970)
- (1)
- (23,539)
- (5)
- (1)
- (1)
- (67)
- (368)
- (4,461)
- (23)
- (1)
- (4)
- (2)
- (13)
- (21,438)
- (3)
- (4)
- (3)
- (1)
- (2)
- (4)
- (14)
- (71)
- (2)
- (2)
- (2)
- (1)
- (3)
- (2)
- (1)
- (157)
- (3)
- (4)
- (1)
- (1)
- (1)
- (3)
- (253)
- (23,055)
- (1)
- (1)
- (2)
- (1)
- (13)
- (26,817)
- (403)
- (32)
- (3)
- (712)
- (14)
- (2)
- (1)
- (8)
- (1)
- (5)
- (1)
- (108)
- (1)
- (3,801)
- (1,406)
- (3)
- (4)
- (5)
- (1)
- (1)
- (1)
- (1)
- (14)
- (138)
- (48)
- (6)
- (17)
- (2)
- (1)
- (10)
- (4)
- (81)
- (12)
- (2)
- (3)
- (80)
- (4)
- (113)
- (96)
- (19)
- (1)
- (1)
- (4)
- (1)
- (1,522)
- (2)
- (1)
- (160)
- (18)
- (48)
- (3)
- (3)
- (1)
- (2)
- (9)
- (27)
- (2)
- (521)
- (384)
- (1)
- (4)
- (1)
- (2)
- (114)
- (44)
- (2)
- (1)
- (1)
- (4)
- (1)
- (1)
- (3)
- (1)
- (23,707)
- (6)
- (3)
- (1)
- (1)
- (63)
- (6)
- (2)
- (7)
- (5)
- (1)
- (2)
- (1)
- (1)
- (6,757)
- (6)
- (4)
- (1)
- (3)
- (1)
- (3)
- (2)
- (13)
- (17)
- (1)
- (3)
- (3)
- (4)
- (27,114)
- (234)
- (1)
- (3)
- (2)
- (1)
- (2)
- (1)
- (89)
- (558)
- (96)
- (2)
- (1)
- (1)
- (2)
- (1)
- (27)
- (1)
- (8)
- (15)
- (1)
- (72)
- (1)
- (1,306)
- (1)
- (3)
- (16)
- (1)
- (3)
- (1)
- (1)
- (1)
- (8)
- (1)
- (4)
- (1)
- (1)
- (29,094)
- (5)
- (22)
- (8)
- (4)
- (1,292)
- (2)
- (1)
- (1)
- (3)
- (1)
- (1)
- (8)
- (14)
- (32)
- (24)
- (1)
- (2)
- (16)
- (233)
- (9)
- (2)
- (5)
- (1)
- (2)
- (2)
- (2)
- (23)
- (5)
- (3)
- (3)
- (2)
- (14)
- (23,574)
- (1)
- (48)
- (15)
- (1)
- (2)
- (45,222)
- (6,555)
- (245)
- (168)
- (56)
- (3,358)
- (7)
- (1)
- (3)
- (18)
- (2)
- (63)
- (1)
- (1)
- (4)
- (2)
- (9)
- (62)
- (1)
- (2)
- (3)
- (1)
- (423)
- (1)
- (2)
- (2)
- (3)
- (2)
- (1)
- (1)
- (1)
- (3)
- (2)
- (5)
- (18)
- (7)
- (2)
- (2)
- (3)
- (45)
- (1)
- (1)
- (1)
- (2)
- (5)
- (1)
- (1)
- (1)
- (2)
- (8)
- (1)
- (1)
- (2)
- (3)
- (43,607)
- (1)
- (11)
Filtered Search Results
R&D Systems™ Recombinant Mouse/Rat TrkC Protein
Extensive quality control produces industry leading bioactivity and lot-to-lot consistency that instills confidence in results and ensures reproducibility. Applications: Bioactivity
| Conjugate | Unconjugated |
|---|---|
| Formulation | Lyophilized from a 0.2μm filtered solution in PBS. |
| Gene ID (Entrez) | 18213 |
| Storage Requirements | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70° C as supplied. 1 month, 2 to 8° C under sterile conditions after reconstitution. 3 months, -20 to -70° C under sterile conditions after reconstitution. |
| Species | Mouse,Rat |
| Regulatory Status | RUO |
|---|---|
| Purity or Quality Grade | >95%, by SDS-PAGE under reducing conditions |
| Conjugate | Unconjugated |
| Form | Liquid |
| Formulation | 20 mM tris HCl with 50% glycerol and no preservative; pH 8 |
| Sequence | Amino acids Met1- Leu241 containing an N-terminal His-tag |
| For Use With (Application) | Control,Western Blot |
| Source | E. coli |
| Name | Human GST Omega 1 140 A |
| Recombinant | Recombinant |
Novus Biologicals™ Recombinant Human Opticin His Protein
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Highly purified. Generating reliable and reproducible results. Applications: SDS-Page
| Purity or Quality Grade | >85%, by SDS-PAGE |
|---|---|
| Conjugate | Unconjugated |
| Gene Alias | oculoglycan, OPT, opticin |
| Common Name | Opticin |
| Molecular Weight (g/mol) | TMW: 37.6kDa |
| Gene ID (Entrez) | 26254 |
| Formulation | 20mM Tris-HCl (pH8.0) containing 10% glycerol |
| Storage Requirements | Store at 4°C short term. Aliquot and store at −20°C long term. Avoid freeze-thaw cycles. |
| Concentration | 0.5mg/mL |
| For Use With (Application) | SDS-PAGE |
| Recombinant | Recombinant |
Novus Biologicals™ MAATS1 Recombinant Protein Antigen
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Recombinant Protein
Novus Biologicals™ Recombinant Human GSTO1 Protein
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Highly purified. Generating reliable and reproducible results.
R&D Systems™ Recombinant Mouse TfR (Transferrin R) Protein
Extensive quality control produces industry leading bioactivity and lot-to-lot consistency that instills confidence in results and ensures reproducibility.
Novus Biologicals™ DRG1 Protein
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Highly purified. Generating reliable and reproducible results.
R&D Systems™ Recombinant Human CD68/SR-D1 Fc Chimera Protein
Measured by its binding ability in a functional ELISA.
Spectrum™ Chemical Albumin, Bovine Serum, Fraction V, Heat-Shock Isolation, BiotechGrade
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
A3611, 9048-46-8
| Form | Lyophilized |
|---|---|
| Packaging | Poly Bottle |
Novus Biologicals™ Recombinant Human GLTPD1 His Protein
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Highly purified. Generating reliable and reproducible results.
| Purity or Quality Grade | >90%, by SDS-PAGE under reducing conditions and visualized by Colloidal Coomassie™ Blue stain |
|---|---|
| Conjugate | Unconjugated |
| Gene Alias | Ceramide-1-Phosphate Transfer Protein, CPTP, Glycolipid Transfer Protein Domain Containing 1, Glycolipid Transfer Protein Domain-Containing Protein 1 |
| Common Name | GLTPD1 |
| Molecular Weight (g/mol) | TMW: 26.8kDa |
| Gene ID (Entrez) | 80772 |
| Formulation | Phosphate buffered saline (pH7.4) containing 50% glycerol, 1mM DTT |
| Storage Requirements | Store at 4°C short term. Aliquot and store at −20°C long term. Avoid freeze-thaw cycles. |
| Concentration | 0.25mg/mL |
| For Use With (Application) | SDS-PAGE |
| Recombinant | Recombinant |
Invitrogen™ Human Rbm20 (aa 667-757) Control Fragment Recombinant Protein
Recombinant Protein
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
| Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
|---|---|
| Conjugate | Unconjugated |
| pH Range | 7.4 |
| Form | Liquid |
| Common Name | Rbm20 |
| Gene Symbol | Rbm20 |
| Storage Requirements | -20°C, Avoid Freeze/Thaw Cycles |
| Sequence | ADWGNGRDSWEHSPYARREEERDPAPWRDNGDDKRDRMDPWAHDRKHHPRQLDKAELDERPEGGRPHREKYPRSGSPNLPHSVSSYKSRED |
| Concentration | 1.10 mg/mL |
| Expression System | E. coli |
| For Use With (Application) | Neutralization,Control |
| Name | Human Rbm20 (aa 667-757) Control Fragment |
| Accession Number | Q5T481 |
| Regulatory Status | RUO |
| Purification Method | Metal-chelate chromatography |
| Gene Alias | 1110018J23Rik; 2010003H22Rik; AI646761; probable RNA-binding protein 20; Rbm20; RNA binding motif protein 20; RNA-binding motif protein 20; RNA-binding protein 20 |
| Product Type | Protein |
| Gene ID (Entrez) | 282996 |
| Formulation | PBS, 1M urea with no preservative; pH 7.4 |
| Protein Tag | His-ABP-tag |
| Recombinant | Recombinant |
R&D Systems™ Recombinant Mouse TIM-4 Protein
Extensive quality control produces industry leading bioactivity and lot-to-lot consistency that instills confidence in results and ensures reproducibility. Applications: Bioactivity
Novus Biologicals™ ERRFI1 Recombinant Protein Antigen
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Recombinant Protein