accessibility menu, dialog, popup

UserName
Viewing profile as user:

Antibodies

Antibodies are glycoproteins that serve an essential role in the immune system to protects animals from infection, or the cytotoxic effects of foreign compounds, by binding with high affinity to invasive molecules; classified as primary or secondary.
Primary Antibodies (75)
Antibody Panels and Kits (1)
Showing products from the Antibodies category. View All Search Results

Filtered Search Results

Products from some of our suppliers do not display in filtered search results. Please clear all filters to see these products.

Narrow Results

Selected Filters

Clear all

brands

Novus Biologicals
R&D Systems

Applications

Simple Western

Conjugate

Unconjugated

Narrow Results

Narrow Results

category

special offers

  • (21)

brands

  • (18)
  • (58)

special interests

  • (16)
  • (18)

Applications

  • (76)
  • (8)
  • (72)
  • (65)
  • (30)
  • (5)
  • (21)
  • (424)
  • (502)
  • (708)
  • (8)
  • (6)
  • (6)
  • (2)
  • (7,174)
  • (1)
  • (9)
  • (28)
  • (402)
  • (32,091)
  • (1)
  • (1)
  • (6)
  • (23,012)
  • (4)
  • (48)
  • (3,487)
  • (2)
  • (41)
  • (2)
  • (84)
  • (17)
  • (2)
  • (824)
  • (168)
  • (38,629)
  • (4,340)
  • (18)
  • (11)
  • (48,166)
  • (68,206)
  • (84)
  • (2,895)
  • (63,368)
  • (37)
  • (15,495)
  • (112)
  • (50)
  • (131)
  • (15)
  • (46)
  • (1,559)
  • (39)
  • (4)
  • (2)
  • (7)
  • (68)
  • (34)
  • (2,851)
  • (1)
  • (1)
  • (1)
  • (4)
  • (1,394)
  • (7)
  • (22)
  • (41)
  • (5)
  • (160)
  • (892)
  • (7)
  • (45)
  • (34)
  • (3)
  • (4)
  • (26)
  • (110,827)
  • (1)
  • (11)

Conjugate

  • (76)
  • (53)
  • (13)
  • (6)
  • (3)
  • (53)
  • (15)
  • (7)
  • (7)
  • (13)
  • (49)
  • (263)
  • (51)
  • (48)
  • (46)
  • (47)
  • (55)
  • (47)
  • (51)
  • (50)
  • (42)
  • (48)
  • (319)
  • (54)
  • (316)
  • (316)
  • (53)
  • (320)
  • (53)
  • (65)
  • (41)
  • (41)
  • (40)

Form

  • (76)

Quantity

  • (1)
  • (3)
  • (1)
  • (2)
  • (3)
  • (33)
  • (1)
  • (1)
  • (29)
  • (1)
  • (1)

Regulatory Status

  • (76)

Target Species

  • (1)
  • (2)
  • (66)
  • (2)
  • (6)
  • (2)
  • (3)
  • (1)

Classification

  • (63)
  • (12)

Host Species

  • (50)
  • (23)
  • (2)

Isotype

  • (20)
  • (11)
  • (1)
  • (8)
  • (26)
Search Within Results
Keyword Search:
1 – 15 of 43 results
1

p62/SQSTM1 Antibody (2533B) - BSA Free, Novus Biologicals™
SDP

Rabbit Monoclonal Antibody

Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Target Species Human
Host Species Rabbit
Conjugate Unconjugated
Applications Western Blot,Simple Western,Immunohistochemistry,Immunofluorescence,Immunohistochemistry (Paraffin)
Form Purified
Research Discipline Adaptive Immunity, Cancer, Chromatin Modifiers, Chromatin Research, DNA Methyltransferases, Epigenetics, Innate Immunity, Tumor Suppressors
Concentration 1.0 mg/mL
Antigen p62/SQSTM1
Regulatory Status RUO
Purification Method Protein A or G purified
Dilution Western Blot 1 μg/ml, Simple Western 20 μg/ml, Immunohistochemistry 8-25 μg/ml, Immunocytochemistry/ Immunofluorescence 8-25 μg/ml, Immunohistochemistry-Paraffin 8-25 μg/ml, Knockout Validated
Gene Alias A170, Autophagy Receptor P62, DMRV, EBI3-associated protein of 60 kDa, EBI3-associated protein p60, EBIAP, FTDALS3, NADGP, ORCA, OSIL, oxidative stress induced like, p60PDB3, p62, p62B, Paget disease of bone 3, PDB3, phosphotyrosine independent ligand for the Lck SH2 domain p62, Phosphotyrosine-independent ligand for the Lck SH2 domain of 62 kDa, sequestosome 1, sequestosome-1, Ubiquitin-binding protein p62, ZIP3
Gene ID (Entrez) 8878
Formulation PBS
Immunogen Partial recombinant human p62/SQSTM1 protein produced in E. coli (amino acids 368-440) [UniProt Q13501]
Classification Monoclonal
Primary or Secondary Primary
Clone 2533B
2

Human AMPKβ1 Antibody, Novus Biologicals™

Mouse Monoclonal Antibody

Content And Storage Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70°CC as supplied. 1 month, 2 to 8°CC under sterile conditions after reconstitution. 6 months, -20 to -70°CC under sterile conditions after reconstitution.
Target Species Human
Host Species Mouse
Conjugate Unconjugated
Applications Western Blot,Immunohistochemistry,Simple Western
Form Purified
Isotype IgG2b
Gene Accession No. Q9Y478
Antigen AMPK beta 1
Regulatory Status RUO
Purification Method Protein A or G purified from hybridoma culture supernatant
Dilution Western Blot 1 μg/mL, Simple Western 10 μg/mL, Immunohistochemistry 0.5-25 μg/mL
Gene Alias 5'-AMP-activated protein kinase beta-1 subunit, AMP-activated protein kinase beta subunit, AMPK, AMPK beta -1 chain, AMPK beta 1,5'-AMP-activated protein kinase subunit beta-1, AMPK subunit beta-1, AMPKb, HAMPKb, MGC17785, PRKAB1, protein kinase, AMP-activated, beta 1 non-catalytic subunit, protein kinase, AMP-activated, noncatalytic, beta-1
Gene ID (Entrez) 5564
Formulation Lyophilized from a 0.2μm filtered solution in PBS with Trehalose. See Certificate of Analysis for details. *Small pack size (-SP) is supplied either lyophilized or as a 0.2μm filtered solution in PBS.
Immunogen E. coli- derived recombinant human AMPKbeta1, Met1-Ile270, Accession # Q9Y478
Classification Monoclonal
Reconstitution Reconstitute lyophilized material at 0.2 mg/ml in sterile PBS. For liquid material, refer to CoA for concentration.
Primary or Secondary Primary
Clone 1092531
3
Promotions Available

Human VISTA/B7-H5/PD-1H Antibody, R&D Systems™

Rabbit Monoclonal Antibody

Content And Storage Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 °C as supplied. 1 month, 2 to 8 °C under sterile conditions after reconstitution. 6 months, -20 to -70 °C under sterile conditions after reconstitution.
Target Species Human
Host Species Rabbit
Conjugate Unconjugated
Applications Western Blot,Simple Western
Form Purified
Isotype IgG
Gene Accession No. Q9H7M9
Antigen VISTA/B7-H5/PD-1H
Regulatory Status RUO
Purification Method Protein A or G purified from hybridoma culture supernatant
Dilution Western Blot 2 μg/mL, Simple Western 2-10 μg/mL
Gene Alias 4632428N05Rik, B7H5, B7-H5, C10orf54, chromosome 10 open reading frame 54, Dies1, Gi24, PD1H, PD-1H, platelet receptor Gi24, PP2135, SISP1, stress induced secreted protein 1, VSIR
Gene ID (Entrez) 64115
Formulation Lyophilized from a 0.2 Âμm filtered solution in PBS with Trehalose.
Immunogen Synthetic Peptide, Accession # Q9H7M9
Classification Monoclonal
Reconstitution Reconstitute lyophilized material at 0.2 mg/ml in sterile PBS. For liquid material, refer to CoA for concentration.
Primary or Secondary Primary
Clone 3180B
4
Promotions Available

Influenza A Virus H1N1 Hemagglutinin Antibody, R&D Systems™
GREENER_CHOICE

Rabbit Monoclonal Antibody

Content And Storage Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 °C as supplied. 1 month, 2 to 8 °C under sterile conditions after reconstitution. 6 months, -20 to -70 °C under sterile conditions after reconstitution.
Target Species Influenza A virus H1N1
Host Species Rabbit
Conjugate Unconjugated
Applications Western Blot,Simple Western,Immunocytochemistry
Form Purified
Gene Accession No. YP_009118626
Antigen Hemagglutinin/HA Peptide
Regulatory Status RUO
Purification Method Protein A or G purified from cell culture supernatant
Dilution Western Blot 1 μg/mL, Simple Western 25 μg/mL, Immunocytochemistry 3-15 μg/mL
Formulation Lyophilized from a 0.2 μm filtered solution in PBS with Trehalose. *Small pack size (SP) is supplied either lyophilized or as a 0.2 μm filtered solution in PBS.
Immunogen Human embryonic kidney cell, HEK293-derived influenza a virus H1N1 Hemagglutinin with a C-terminal 6-His tag, Met1-Gln529, Accession # YP_009118626
Classification Monoclonal
Reconstitution Reconstitute at 0.5 mg/mL in sterile PBS.
Primary or Secondary Primary
Clone 2908F
5

Human G6PD Antibody, R&D Systems™
GREENER_CHOICE

Mouse Monoclonal Antibody

Content And Storage Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 °C as supplied. 1 month, 2 to 8 °C under sterile conditions after reconstitution. 6 months, -20 to -70 °C under sterile conditions after reconstitution.
Target Species Human
Host Species Mouse
Conjugate Unconjugated
Applications Western Blot,Simple Western,Immunohistochemistry
Form Purified
Gene Accession No. P11413
Antigen Glucose 6 Phosphate Dehydrogenase
Regulatory Status RUO
Purification Method Protein A or G purified from hybridoma culture supernatant
Dilution Western Blot 1 μg/mL, Simple Western 10 μg/mL, Immunohistochemistry 3-25 μg/mL
Gene Alias G6PD, G6PD1EC 1.1.1.49, G6PDH, glucose-6-phosphate dehydrogenase
Gene ID (Entrez) 2539
Formulation Lyophilized from a 0.2 μm filtered solution in PBS with Trehalose. *Small pack size (SP) is supplied either lyophilized or as a 0.2 μm filtered solution in PBS.
Immunogen E. coli-derived human G6PD, Ala2-Leu515, Accession # P11413
Classification Monoclonal
Reconstitution Reconstitute at 0.5 mg/mL in sterile PBS.
Primary or Secondary Primary
Clone 1067503
6
Promotions Available

Human CD31/PECAM-1 Antibody, Novus Biologicals Biologicals™

Mouse Monoclonal Antibody

Content And Storage Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70°C as supplied. 1 month, 2 to 8°C under sterile conditions after reconstitution. 6 months, -20 to -70°C under sterile conditions after reconstitution.
Target Species Human
Host Species Mouse
Conjugate Unconjugated
Applications Western Blot,Simple Western,Immunohistochemistry,Multiplex Immunofluorescence
Form Purified
Isotype IgG2b
Gene Accession No. P16284
Antigen CD31/PECAM-1
Regulatory Status RUO
Purification Method Protein A or G purified from hybridoma culture supernatant
Dilution Western Blot 2 μg/mL, Simple Western 5 μg/mL, Immunohistochemistry 0.05-10 μg/mL, Multiplex Immunofluorescence 0.1 μg/mL
Gene Alias adhesion molecule, CD31, CD31 antigen, CD31/EndoCAM, EndoCAM, FLJ34100, FLJ58394, GPIIA', PECA1, PECAM1, PECAM-1, PECAM-1, CD31/EndoCAM, platelet endothelial cell adhesion molecule, platelet endothelial cell adhesion molecule-1, platelet/endothelial cell adhesion molecule
Product Type Antibody
Gene ID (Entrez) 5175
Formulation Lyophilized from a 0.2μm filtered solution in PBS with Trehalose.
Immunogen Chinese Hamster Ovary cell line, CHO-derived recombinant human CD31/PECAM01, Gln28-Lys601, Accession # P16284
Classification Monoclonal
Reconstitution Reconstitute lyophilized material at 0.2 mg/mL in sterile PBS. For liquid material, refer to CoA for concentration.
Primary or Secondary Primary
Clone 1094431
7

Human SDHA Antibody, Novus Biologicals™

Mouse Monoclonal Antibody

Content And Storage Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 °C as supplied. 1 month, 2 to 8 °C under sterile conditions after reconstitution. 6 months, -20 to -70 °C under sterile conditions after reconstitution.
Target Species Human
Host Species Mouse
Conjugate Unconjugated
Applications Immunohistochemistry,Western Blot,Simple Western,Immunocytochemistry
Form Purified
Isotype IgG2b
Gene Accession No. P31040
Antigen SDHA
Regulatory Status RUO
Purification Method Protein A or G purified from hybridoma culture supernatant
Dilution Western Blot 1 μg/mL, Simple Western 20 μg/mL, Immunohistochemistry 3-25 μg/mL, Immunocytochemistry 3-25 μg/mL
Gene Alias CMD1GG, flavoprotein subunit of complex II, FP, MC2DN1, NDAXOA, PGL5, PPGL5, SDH1, SDH2, SDHF, succinate dehydrogenase complex, subunit A, flavoprotein (Fp)
Gene ID (Entrez) 6389
Formulation Lyophilized from a 0.2μm filtered solution in PBS with Trehalose.
Immunogen Synthetic Peptide, Accession # P31040
Classification Monoclonal
Reconstitution Reconstitute lyophilized material at 0.2 mg/ml in sterile PBS. For liquid material, refer to CoA for concentration.
Primary or Secondary Primary
Clone 1084056
8

Human Cytokeratin 17 Antibody, R&D Systems™

Mouse Monoclonal Antibody

Content And Storage Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20°C to -70 °C as supplied. 1 month, 2 to 8 °C under sterile conditions after reconstitution. 6 months, -20°C to -70 °C under sterile conditions after reconstitution.
Target Species Human
Host Species Mouse
Conjugate Unconjugated
Applications Immunocytochemistry,Western Blot,Simple Western,Immunohistochemistry
Form Purified
Isotype IgG2b
Gene Accession No. Q04695
Antigen Cytokeratin 17
Regulatory Status RUO
Purification Method Protein A or G purified from hybridoma culture supernatant
Dilution Western Blot 2 μg/mL, Simple Western 100 μg/mL, Immunohistochemistry 3-25 μg/mL, Immunocytochemistry 3-25 μg/mL
Gene Alias 39.1, CK-17, cytokeratin-17, K17, keratin 17, keratin 17, type I, keratin, type I cytoskeletal 17, keratin-17, PC, PC2, PCHC1
Gene ID (Entrez) 3872
Formulation Lyophilized from a 0.2 μm filtered solution in PBS with Trehalose.
Immunogen Cytokeratin 17 containing synthetic peptide, Accession # Q04695
Classification Monoclonal
Reconstitution Reconstitute lyophilized material at 0.2mg/mL in sterile PBS. For liquid material, refer to CoA for concentration.
Primary or Secondary Primary
Clone 1080235
9

Human MAG/Siglec-4a Antibody, R&D Systems™

Mouse Monoclonal Antibody

Content And Storage Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 °C as supplied. 1 month, 2 to 8 °C under sterile conditions after reconstitution. 6 months, -20 to -70 °C under sterile conditions after reconstitution.
Target Species Human
Host Species Mouse
Conjugate Unconjugated
Applications Western Blot,Simple Western
Form Purified
Isotype IgG2b
Antigen MAG/Siglec-4a
Regulatory Status RUO
Purification Method Protein A or G purified from hybridoma culture supernatant
Dilution Western Blot 0.1 μg/mL, Simple Western 10 μg/mL
Gene Alias GMAsialic acid binding Ig-like lectin 4A, myelin associated glycoprotein, myelin-associated glycoprotein, sialic acid-binding immunoglobulin-like lectin 4A, Siglec4a, SIGLEC-4A, S-MAG
Gene ID (Entrez) 4099
Formulation Lyophilized from a 0.2 μm filtered solution in PBS with Trehalose.
Immunogen Human embryonic kidney cell, HEK293-derived human MAG/Siglec-4a, Gly20-Pro516
Classification Monoclonal
Reconstitution Reconstitute lyophilized material at 0.2 mg/ml in sterile PBS. For liquid material, refer to CoA for concentration.
Primary or Secondary Primary
Clone 1099506
10

Human Desmin Antibody, R&D Systems™

Mouse Monoclonal Antibody

Content And Storage Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20°C to -70 °C as supplied. 1 month, 2 to 8 °C under sterile conditions after reconstitution. 6 months, -20°C to -70 °C under sterile conditions after reconstitution.
Target Species Human
Host Species Mouse
Conjugate Unconjugated
Applications Immunocytochemistry,Western Blot,Simple Western,Immunohistochemistry,Multiplex
Form Purified
Isotype IgG2a
Gene Accession No. P17661
Antigen Desmin
Regulatory Status RUO
Purification Method Protein A or G purified from hybridoma culture supernatant
Dilution Western Blot 1 μg/mL, Simple Western 20 μg/mL, Immunohistochemistry 3-25 μg/mL, Immunocytochemistry 3-25 μg/mL, Multiplex Immunofluorescence 1 μg/mL
Gene Alias CMD1I, CMD1IFLJ41013, CSM1, CSM2, DES, desmin, FLJ12025, FLJ39719, FLJ41793, intermediate filament protein
Gene ID (Entrez) 1674
Formulation Lyophilized from a 0.2 μm filtered solution in PBS with Trehalose.
Immunogen E. coli derived recombinant human Desmin, Accession # P17661
Classification Monoclonal
Reconstitution Reconstitute lyophilized material at 0.2 mg/mL in sterile PBS. For liquid material, refer to CoA for concentration.
Primary or Secondary Primary
Clone 1089115
11

Mineralocorticoid R/NR3C2 Antibody, Novus Biologicals™
SDP

Rabbit Polyclonal Antibody

Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Target Species Human
Host Species Rabbit
Conjugate Unconjugated
Applications Western Blot,Simple Western,Immunofluorescence,Immunoprecipitation
Form Purified
Isotype IgG
Antigen Mineralocorticoid R/NR3C2
Regulatory Status RUO
Purification Method Antigen and protein A Affinity-purified
Dilution Western Blot 1:500-1:2000, Simple Western, Immunocytochemistry/Immunofluorescence 1:300-1:10000, Immunoprecipitation 1-4 uL/mg of lysate
Gene Alias FLJ41052, MGC133092, mineralocorticoid receptor 1, mineralocorticoid receptor delta, MLRmineralocorticoid receptor, MRMCRaldosterone receptor, NR3C2VIT, Nuclear receptor subfamily 3 group C member 2, nuclear receptor subfamily 3, group C, member 2
Gene ID (Entrez) 4306
Formulation 0.2 μm filtered solution in PBS
Immunogen Produced in rabbits immunized with a synthetic peptide corresponding to the C-terminus of the Human Mineralocorticoid R/NR3C2.
Classification Polyclonal
Primary or Secondary Primary
12

TcBuster-M Transposase Antibody, Novus Biologicals™

Mouse Monoclonal Antibody

Content And Storage Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 °C as supplied. 1 month, 2 to 8 °C under sterile conditions after reconstitution. 6 months, -20 to -70 °C under sterile conditions after reconstitution.
Target Species Broad Species Reactivity
Host Species Mouse
Conjugate Unconjugated
Applications Western Blot,Simple Western
Form Purified
Isotype IgG2b
Antigen TcBuster Transposase
Regulatory Status RUO
Purification Method Protein A or G purified from hybridoma culture supernatant
Dilution Western Blot 1 μg/mL, Simple Western 20 μg/mL
Gene Alias GLEAN_06077, TcasGA2_TC006077, Transposase
Formulation Lyophilized from a 0.2μm filtered solution in PBS with Trehalose. See Certificate of Analysis for details. *Small pack size (-SP) is supplied either lyophilized or as a 0.2μm filtered solution in PBS.
Immunogen Synthetic Peptide
Classification Monoclonal
Reconstitution Reconstitute at 0.5 mg/mL in sterile PBS. For liquid material, refer to CoA for concentration.
Primary or Secondary Primary
Clone 1077035
13

Human Cdk6 Antibody, Novus Biologicals™

Mouse Monoclonal Antibody

Content And Storage Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70°CC as supplied. 1 month, 2 to 8°CC under sterile conditions after reconstitution. 6 months, -20 to -70°CC under sterile conditions after reconstitution.
Target Species Human
Host Species Mouse
Conjugate Unconjugated
Applications Western Blot,Simple Western,Immunohistochemistry,Immunocytochemistry
Form Purified
Isotype IgG2b
Gene Accession No. Q00534
Antigen Cdk6
Regulatory Status RUO
Purification Method Protein A or G purified from hybridoma culture supernatant
Dilution Western Blot 0.5 μg/mL, Simple Western 10 μg/mL, Immunohistochemistry 3-25 μg/mL, Immunocytochemistry 3-25 μg/mL
Gene Alias CDKN6, Cell division protein kinase 6, cyclin-dependent kinase 6, EC 2.7.11, EC 2.7.11.22, PLSTIREMGC59692, Serine/threonine-protein kinase PLSTIRE
Gene ID (Entrez) 1021
Formulation Lyophilized from a 0.2μm filtered solution in PBS with Trehalose.
Immunogen E. coli -derived recombinant human CDK-6, Met1-Ala326, Accession # Q00534
Classification Monoclonal
Reconstitution Reconstitute lyophilized material at 0.2 mg/ml in sterile PBS. For liquid material, refer to CoA for concentration.
Primary or Secondary Primary
Clone 1092920
14

GFP Antibody, Novus Biologicals™
SDP

Rabbit Polyclonal Antibody

Content And Storage Store at -20°C short term. Aliquot and store at -80°C long term. Avoid freeze-thaw cycles.
Target Species Non-species specific
Host Species Rabbit
Conjugate Unconjugated
Applications Western Blot,Simple Western,Flow Cytometry,ELISA,Immunohistochemistry
Form Purified
Isotype IgG
Research Discipline Epitope Tags
Antigen GFP
Regulatory Status RUO
Purification Method Immunogen affinity purified
Dilution Western Blot 1:1000-1:3000, Simple Western, Flow Cytometry 1:10 - 1:1000, ELISA 1:10000-1:40000, Immunohistochemistry 1:10 - 1:500, Immunocytochemistry/Immunofluorescence 1:10 - 1:500, Immunoprecipitation 1:10 - 1:500, Immunohistochemistry-Paraffin 1:10 - 1:500, Immunohistochemistry-Frozen 1:10 - 1:500, Electron Microscopy, Chromatin Immunoprecipitation (ChIP)
Gene Alias Enhanced Green Fluorescent Protein, Green Fluorescent Protein, green fluorescent protein (gfp)
Formulation 0.02 M Potassium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Classification Polyclonal
Immunogen The immunogen is a Green Fluorescent Protein (GFP) fusion protein corresponding to the full length amino acid sequence (246aa) derived from the jellyfish Aequorea victoria.
Primary or Secondary Primary
15

ATP5A Antibody - BSA Free, Novus Biologicals™
SDP

Rabbit Polyclonal Antibody

Content And Storage Store at -20°C. Avoid freeze-thaw cycles.
Target Species Human,Mouse,Rat
Host Species Rabbit
Conjugate Unconjugated
Applications Western Blot,Simple Western,Immunofluorescence
Form Purified
Isotype IgG
Research Discipline Endocrinology, Neurodegeneration, Neuroscience, Signal Transduction
Antigen ATP5A
Regulatory Status RUO
Purification Method Affinity purified
Dilution Western Blot 1:500 - 1:1000, Simple Western, Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
Gene Alias ATP synthase, H+ transporting, mitochondrial F1 complex, alpha subunit 1, ATP synthase, H+ transporting, mitochondrial F1 complex, alpha subunit, isoform1, cardiac muscle, ATP synthase, H+ transporting, mitochondrial F1 complex, alpha subunit, isoform2, non-cardiac muscle-like 2, ATP sythase (F1-ATPase) alpha subunit, ATP5AL2, ATP5AMOM2, ATPMATP synthase subunit alpha, mitochondrial, cardiac muscle, EC 3.6.3, EC 3.6.3.14, hATP1, mitochondrial ATP synthetase, oligomycin-resistant, OMR, ORMATP synthase alpha chain, mitochondrial
Gene ID (Entrez) 498
Formulation PBS with 50% glycerol, pH7.3.
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-280 of human ATP5A1 (NP_004037.1). MLSVRVAAAVVRALPRRAGLVSRNALGSSFIAARNFHASNTHLQKTGTAEMSSILEERILGADTSVDLEETGRVLSIGDGIARVHGLRNVQAEEMVEFSSGLKGMSLNLEPDNVGVVVFGNDKLIKEGDIVKRTGAIVDVPVGEELLGRVVDALGNAIDGKGPIGSKTRRRVGLKAPGIIPRISVREPMQTGIKAVDSLVPIGRGQRELIIGDRQTGKTSIAIDTIINQKRFNDGSDEKKKLYCIYVAIGQKRSTVAQLVKRLTDADAMKYTIVVSATAS
Classification Polyclonal
Primary or Secondary Primary