accessibility menu, dialog, popup

UserName
Viewing profile as user:

Filtered Search Results

Products from some of our suppliers do not display in filtered search results. Please clear all filters to see these products.

Narrow Results

Narrow Results

category

Show all

brands

  • (64)
  • (3)
  • (243)
  • (1)
  • (21)
  • (8)
  • (69)
  • (33)
  • (7)
  • (4)
  • (2)
  • (5)
  • (2)
  • (70)
  • (4)
  • (148)
  • (4)
  • (2)
  • (19)
  • (22)
  • (35)
  • (3)
  • (22)
  • (6)
  • (3)
  • (2)
  • (3)
  • (62)
  • (1)
  • (1)
  • (111)
  • (3)
  • (3)
  • (8)
  • (21)
  • (3)
  • (36)

special interests

  • (6)
  • (11)
  • (618)

Conjugate

  • (1)
  • (2)
  • (2)
  • (2)
  • (2)
  • (2)
  • (2)
Show all

Applications

  • (7)
  • (71)
  • (63)
  • (27)
  • (32)
  • (63)
  • (4)
Show all

Classification

  • (92)
  • (50)
  • (4)
  • (1)
  • (1)

Host Species

  • (1)
  • (2)
  • (32)
  • (83)
  • (30)

Quantity

  • (4)
  • (2)
  • (58)
  • (5)
  • (7)
  • (22)
  • (16)
Show all

Target Species

  • (8)
  • (7)
  • (7)
  • (9)
  • (86)
  • (93)
  • (2)
Show all

Regulatory Status

  • (147)

Isotype

  • (61)
  • (30)
  • (18)
  • (6)
  • (29)
  • (1)

Form

  • (39)
  • (4)
  • (45)

Sample Type

  • (1)
  • (6)
  • (12)
  • (1)

Search results for "iba+stimulation+peptide"

There were no precise results for "iba+stimulation+peptide". Showing all possible results.
1 – 15 of 1,028 results
2

CREG2 Antibody, Novus Biologicals™
SDP

Rabbit Polyclonal Antibody

Antigen CREG2
Gene Symbols CREG2
Regulatory Status RUO
Molecular Weight of Antigen 32 kDa
Gene Alias cellular repressor of E1A-stimulated genes 2
Host Species Rabbit
Conjugate Unconjugated
Applications Western Blot
Gene ID (Entrez) 200407
Immunogen Synthetic peptides corresponding to CREG2(cellular repressor of E1A-stimulated genes 2) The peptide sequence was selected from the N terminal of CREG2. Peptide sequence VSSVSWAVTNEVDEELDSASTEEAMPALLEDSGSIWQQSFPASAHKEDAH.
Classification Polyclonal
Isotype IgG
Primary or Secondary Primary
3

STRA6 Antibody, Novus Biologicals™
SDP

Rabbit Polyclonal Antibody

Target Species Human
Host Species Rabbit
Conjugate Unconjugated
Applications Western Blot
Isotype IgG
Gene Accession No. Q9BX79
Antigen STRA6
Gene Symbols STRA6
Regulatory Status RUO
Molecular Weight of Antigen 73 kDa
Gene Alias FLJ12541, MCOPS9, stimulated by retinoic acid gene 6 homolog (mouse), stimulated by retinoic acid gene 6 protein homolog
Gene ID (Entrez) 64220
Immunogen Synthetic peptides corresponding to STRA6(stimulated by retinoic acid gene 6 homolog (mouse)) The peptide sequence was selected from the N terminal of STRA6 (NP_071764). Peptide sequence MSSQPAGNQTSPGATEDYSYGSWYIDEPQGGEELQPEGEVPSCHTSIPPG.
Classification Polyclonal
Primary or Secondary Primary
4

MilliporeSigma™ Calbiochem™ Calcineurin Autoinhibitory Peptide, Cell-permeable

The Calcineurin Autoinhibitory Peptide, Cell-permeable controls the biological activity of Mn2+-stimulated calcineurin activity. This small molecule/inhibitor is primarily used for Phosphorylation & Dephosphorylation applications.

5

TP53I13 Antibody, Novus Biologicals™
SDP

Rabbit Polyclonal Antibody

Host Species Rabbit
Conjugate Unconjugated
Applications Western Blot
Isotype IgG
Gene Accession No. NP_612358
Antigen TP53I13
Gene Symbols TP53I13
Regulatory Status RUO
Molecular Weight of Antigen 42 kDa
Gene Alias DSCP1Damage-stimulated cytoplasmic protein 1, tumor protein p53 inducible protein 13, tumor protein p53-inducible protein 13
Gene ID (Entrez) 90313
Immunogen Synthetic peptide directed towards the C terminal of human TP53I13The immunogen for this antibody is TP53I13. Peptide sequence YWGPTADSQDTVAAVLKRRLLQPSRRVKRSRRRPLLPPTPDSGPEGESSE.
Classification Polyclonal
Primary or Secondary Primary
6

Angiotensin II, MP Biomedicals™

Angiotensin II Human From Synthetic, Powder

CAS 68521-88-0
Color Off-white
7

ACTH Antibody (CLIP/1407) - Azide and BSA Free, Novus Biologicals™
SDP

Mouse Monoclonal Antibody

Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Target Species Human
Host Species Mouse
Conjugate Unconjugated
Applications Flow Cytometry,ELISA,Immunohistochemistry (Paraffin),Immunofluorescence,CyTOF
Form Purified
Isotype IgG
Research Discipline Neuroscience, Nutrient Sensing in the Brain
Concentration 1.0 mg/mL
Antigen ACTH
Gene Symbols POMC
Regulatory Status RUO
Purification Method Protein A or G purified
Dilution Flow Cytometry : 0.5-1ug/million cells, ELISA, Immunohistochemistry-Paraffin : 0.5-1ug/ml, Immunofluorescence : 1-2ug/ml, CyTOF-ready
Gene Alias ACTH, adrenocorticotropic hormone, adrenocorticotropin, alpha-melanocyte-stimulating hormone, alpha-MSH, beta-endorphin, beta-LPH, beta-melanocyte-stimulating hormone, beta-MSH, CLIP, corticotropin-like intermediary peptide, corticotropin-lipotropin, gamma-LPH, gamma-MSH, lipotropin beta, lipotropin gamma, LPH, melanotropin alpha, melanotropin beta, melanotropin gamma, met-enkephalin, MSH, NPP, POC, pro-ACTH-endorphin, proopiomelanocortin, pro-opiomelanocortin, proopiomelanocortin preproprotein
Gene ID (Entrez) 5443
Formulation PBS with No Preservative
Immunogen Synthetic peptide corresponding to aa25-39 of human ACTH (NGAEDESAEAFPLEF)
Classification Monoclonal
Primary or Secondary Primary
Test Specificity ACTH (same as Corticotropin) is a 39 amino acid active peptide produced by the anterior pituitary. This MAb is specific to CLIP (aa25-39 of ACTH); does not react with Synacthen (aa1-24 of ACTH). POMC (pro-opiomelanocortin or corticotropin-lipotropin) is a 267 amino acid polypeptide hormone precursor that goes through extensive, tissue-specific posttranslational processing by convertases. POMC is cleaved into ten hormone chains named NPP, ACTH, alpha-MSH (Melanocyte Stimulating Hormone), beta-MSH, gamma-MSH, CLIP (corticotropin-like intermediary peptide), Lipotropin-beta, Lipotropin-gamma, beta-endorphin and Met-enkephalin. ACTH is also produced by cells of immune system (T-cells, B-cells, and macrophages) in response to stimuli associated with stress. Anti-ACTH is a useful marker in classification of pituitary tumors and the study of pituitary disease. It reacts with ACTH-producing cells (corticotrophs). It also may react with other tumors (e.g. some small cell carcinomas of the lung) causing paraneoplastic syndromes by secreting ACTH.
Clone CLIP/1407
8

ACTH Antibody (CLIP/1407), Novus Biologicals™
SDP

Mouse Monoclonal Antibody

Content And Storage Store at 4C.
Target Species Human
Host Species Mouse
Conjugate Unconjugated
Applications Flow Cytometry,Immunohistochemistry (Paraffin),SDS-Page,Immunofluorescence
Form Purified
Isotype IgG
Gene Accession No. P01189
Research Discipline Neuroscience, Nutrient Sensing in the Brain
Antigen ACTH
Gene Symbols POMC
Regulatory Status RUO
Purification Method Protein A or G purified
Dilution Flow Cytometry 0.5-1ug/million cells, Immunohistochemistry-Paraffin 0.5-1ug/ml, SDS-Page, Immunofluorescence 1-2ug/ml
Gene Alias ACTH, adrenocorticotropic hormone, adrenocorticotropin, alpha-melanocyte-stimulating hormone, alpha-MSH, beta-endorphin, beta-LPH, beta-melanocyte-stimulating hormone, beta-MSH, CLIP, corticotropin-like intermediary peptide, corticotropin-lipotropin, gamma-LPH, gamma-MSH, lipotropin beta, lipotropin gamma, LPH, melanotropin alpha, melanotropin beta, melanotropin gamma, met-enkephalin, MSH, NPP, POC, pro-ACTH-endorphin, proopiomelanocortin, pro-opiomelanocortin, proopiomelanocortin preproprotein
Gene ID (Entrez) 5443
Formulation 10mM PBS and 0.05% BSA with 0.05% Sodium Azide
Immunogen Synthetic peptide corresponding to aa25-39 of human ACTH (NGAEDESAEAFPLEF)
Classification Monoclonal
Primary or Secondary Primary
Test Specificity ACTH (same as Corticotropin) is a 39 amino acid active peptide produced by the anterior pituitary. This MAb is specific to CLIP (aa25-39 of ACTH); does not react with Synacthen (aa1-24 of ACTH). POMC (pro-opiomelanocortin or corticotropin-lipotropin) is a 267 amino acid polypeptide hormone precursor that goes through extensive, tissue-specific posttranslational processing by convertases. POMC is cleaved into ten hormone chains named NPP, ACTH, alpha-MSH (Melanocyte Stimulating Hormone), beta-MSH, gamma-MSH, CLIP (corticotropin-like intermediary peptide), Lipotropin-beta, Lipotropin-gamma, beta-endorphin and Met-enkephalin. ACTH is also produced by cells of immune system (T-cells, B-cells, and macrophages) in response to stimuli associated with stress. Anti-ACTH is a useful marker in classification of pituitary tumors and the study of pituitary disease. It reacts with ACTH-producing cells (corticotrophs). It also may react with other tumors (e.g. some small cell carcinomas of the lung) causing paraneoplastic syndromes by secreting ACTH.
Clone CLIP/1407
9

Lipolysis Stimulated Lipoprotein Receptor Rabbit anti-Human, Polyclonal, Novus Biologicals™
SDP

Rabbit Polyclonal Antibody

10

Lipolysis Stimulated Lipoprotein Receptor Rabbit anti-Human, Polyclonal, Novus Biologicals™
SDP

Rabbit Polyclonal Antibody

11

STRA8 Antibody, Novus Biologicals™
SDP

Rabbit Polyclonal Antibody

Host Species Rabbit
Conjugate Unconjugated
Applications Western Blot
Isotype IgG
Gene Accession No. Q7Z7C7
Antigen STRA8
Gene Symbols STRA8
Regulatory Status RUO
Dilution Western Blot 1.0 ug/ml
Molecular Weight of Antigen 37 kDa
Gene Alias stimulated by retinoic acid gene 8 homolog (mouse), stimulated by retinoic acid gene 8 protein homolog
Gene ID (Entrez) 346673
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Immunogen The immunogen for this antibody is STRA8 - C-terminal region (NP_872295). Peptide sequence PEEKFQLYMQIINFFKGLSCANTQVKQEASFPVDEEMIMLQCTETFDDED.
Classification Polyclonal
Primary or Secondary Primary
12

ACTH Mouse, Clone: AH26 + 57, Novus Biologicals™
SDP

Mouse Monoclonal Antibody

Content And Storage Store at 4C.
Target Species Human,Mouse,Rat
Host Species Mouse
Conjugate Unconjugated
Applications Western Blot,Flow Cytometry,Immunocytochemistry,Immunofluorescence,Immunoprecipitation,Immunohistochemistry (Paraffin)
Form Purified
Isotype IgG
Gene Accession No. P01189
Research Discipline Neuroscience, Nutrient Sensing in the Brain
Antigen ACTH
Gene Symbols POMC
Regulatory Status RUO
Purification Method Protein A purified
Dilution Western Blot 0.5-1.0ug/ml, Flow Cytometry 0.5-1ug/million cells, Immunocytochemistry/Immunofluorescence 0.5-1ug/ml, Immunoprecipitation 0.5-1ug/500ug protein lysate, Immunohistochemistry-Paraffin 0.5-1ug/ml, Immunohistochemistry-Frozen 0.5-1ug/ml
Gene Alias ACTH, adrenocorticotropic hormone, adrenocorticotropin, alpha-melanocyte-stimulating hormone, alpha-MSH, beta-endorphin, beta-LPH, beta-melanocyte-stimulating hormone, beta-MSH, CLIP, corticotropin-like intermediary peptide, corticotropin-lipotropin, gamma-LPH, gamma-MSH, lipotropin beta, lipotropin gamma, LPH, melanotropin alpha, melanotropin beta, melanotropin gamma, met-enkephalin, MSH, NPP, POC, pro-ACTH-endorphin, proopiomelanocortin, pro-opiomelanocortin, proopiomelanocortin preproprotein
Gene ID (Entrez) 5443
Formulation PBS with 0.05% BSA. with 0.05% Sodium Azide
Immunogen Synthetic peptide corresponding to aa1-24 of human ACTH (AH26); N-terminal fragment of human ACTH conjugated to KLH (57)
Classification Monoclonal
Primary or Secondary Primary
Test Specificity ACTH (same as Corticotropin) is a 39 amino acid active peptide produced by the anterior pituitary. This MAb is specific to Synacthen (aa1-24 of ACTH); does not react with CLIP (aa17-39 of ACTH). POMC (pro-opiomelanocortin or corticotropin-lipotropin) is a 267 amino acid polypeptide hormone precursor that goes through extensive, tissue-specific posttranslational processing by convertases. POMC is cleaved into ten hormone chains named NPP, ACTH, alpha-MSH (Melanocyte Stimulating Hormone), beta-MSH, gamma-MSH, CLIP (corticotropin-like intermediary peptide), Lipotropin-beta, Lipotropin-gamma, beta-endorphin and Met-enkephalin. ACTH is also produced by cells of immune system (T-cells, B-cells, and macrophages) in response to stimuli associated with stress. Anti-ACTH is a useful marker in classification of pituitary tumors and the study of pituitary disease. It reacts with ACTH-producing cells (corticotrophs). It also may react with other tumors (e.g. some small cell carcinomas of the lung) causing paraneoplastic syndromes by secreting ACTH.
Clone AH26 + 57
13

ACTH Mouse, Clone: 57, Novus Biologicals™
SDP

Mouse Monoclonal Antibody

Content And Storage Store at 4C.
Target Species Human,Mouse,Rat
Host Species Mouse
Conjugate Unconjugated
Applications Western Blot,Flow Cytometry,Immunocytochemistry,Immunofluorescence,Immunoprecipitation,Immunohistochemistry (Paraffin)
Form Purified
Isotype IgG1 κ
Gene Accession No. P01189
Research Discipline Neuroscience, Nutrient Sensing in the Brain
Antigen ACTH
Gene Symbols POMC
Regulatory Status RUO
Purification Method Protein A purified
Dilution Western Blot 0.5-1.0ug/ml, Flow Cytometry 0.5-1ug/million cells, Immunocytochemistry/Immunofluorescence 0.5-1ug/ml, Immunoprecipitation 0.5-1ug/500ug protein lysate, Immunohistochemistry-Paraffin 0.5-1ug/ml, Immunohistochemistry-Frozen 0.5-1.0ug/ml
Gene Alias ACTH, adrenocorticotropic hormone, adrenocorticotropin, alpha-melanocyte-stimulating hormone, alpha-MSH, beta-endorphin, beta-LPH, beta-melanocyte-stimulating hormone, beta-MSH, CLIP, corticotropin-like intermediary peptide, corticotropin-lipotropin, gamma-LPH, gamma-MSH, lipotropin beta, lipotropin gamma, LPH, melanotropin alpha, melanotropin beta, melanotropin gamma, met-enkephalin, MSH, NPP, POC, pro-ACTH-endorphin, proopiomelanocortin, pro-opiomelanocortin, proopiomelanocortin preproprotein
Gene ID (Entrez) 5443
Formulation PBS with 0.05% BSA. with 0.05% Sodium Azide
Immunogen N-terminal fragment of human ACTH conjugated to KLH
Classification Monoclonal
Primary or Secondary Primary
Test Specificity ACTH (same as Corticotropin) is a 39 amino acid active peptide produced by the anterior pituitary. This MAb is specific to Synacthen (aa1-24 of ACTH); does not react with CLIP (aa17-39 of ACTH). POMC (pro-opiomelanocortin or corticotropin-lipotropin) is a 267 amino acid polypeptide hormone precursor that goes through extensive, tissue-specific posttranslational processing by convertases. POMC is cleaved into ten hormone chains named NPP, ACTH, alpha-MSH (Melanocyte Stimulating Hormone), beta-MSH, gamma-MSH, CLIP (corticotropin-like intermediary peptide), Lipotropin-beta, Lipotropin-gamma, beta-endorphin and Met-enkephalin. ACTH is also produced by cells of immune system (T-cells, B-cells, and macrophages) in response to stimuli associated with stress. Anti-ACTH is a useful marker in classification of pituitary tumors and the study of pituitary disease. It reacts with ACTH-producing cells (corticotrophs).AIt also may react with other tumors (e.g. some small cell carcinomas of the lung) causing paraneoplastic syndromes by secreting ACTH.
Clone 57
14

ACTH Mouse, Clone: SPM333, Novus Biologicals™
SDP

Mouse Monoclonal Antibody

Content And Storage Store at 4C.
Target Species Human,Mouse,Rat
Host Species Mouse
Conjugate Unconjugated
Applications Flow Cytometry,Immunocytochemistry,Immunofluorescence,Immunohistochemistry (Paraffin)
Form Purified
Isotype IgG1 κ
Gene Accession No. P01189
Research Discipline Neuroscience, Nutrient Sensing in the Brain
Antigen ACTH
Gene Symbols POMC
Regulatory Status RUO
Purification Method Protein A or G purified
Dilution Flow Cytometry 0.5-1ug/million cells, Immunocytochemistry/Immunofluorescence 1-2ug/ml, Immunohistochemistry-Paraffin 0.5-1.0ug/ml
Gene Alias ACTH, adrenocorticotropic hormone, adrenocorticotropin, alpha-melanocyte-stimulating hormone, alpha-MSH, beta-endorphin, beta-LPH, beta-melanocyte-stimulating hormone, beta-MSH, CLIP, corticotropin-like intermediary peptide, corticotropin-lipotropin, gamma-LPH, gamma-MSH, lipotropin beta, lipotropin gamma, LPH, melanotropin alpha, melanotropin beta, melanotropin gamma, met-enkephalin, MSH, NPP, POC, pro-ACTH-endorphin, proopiomelanocortin, pro-opiomelanocortin, proopiomelanocortin preproprotein
Gene ID (Entrez) 5443
Formulation PBS with 0.05% BSA. with 0.05% Sodium Azide
Immunogen Synthetic peptide corresponding to aa1-24 of human ACTH
Classification Monoclonal
Primary or Secondary Primary
Test Specificity ACTH (same as Corticotropin) is a 39 amino acid active peptide produced by the anterior pituitary. This MAb is specific to Synacthen (aa1-24 of ACTH); does not react with CLIP (aa17-39 of ACTH). POMC (pro-opiomelanocortin or corticotropin-lipotropin) is a 267 amino acid polypeptide hormone precursor that goes through extensive, tissue-specific posttranslational processing by convertases. POMC is cleaved into ten hormone chains named NPP, ACTH, alpha-MSH (Melanocyte Stimulating Hormone), beta-MSH, gamma-MSH, CLIP (corticotropin-like intermediary peptide), Lipotropin-beta, Lipotropin-gamma, beta-endorphin and Met-enkephalin. ACTH is also produced by cells of immune system (T-cells, B-cells, and macrophages) in response to stimuli associated with stress. Anti-ACTH is a useful marker in classification of pituitary tumors and the study of pituitary disease. It reacts with ACTH-producing cells (corticotrophs). It also may react with other tumors (e.g. some small cell carcinomas of the lung) causing paraneoplastic syndromes by secreting ACTH.
Clone SPM333
15

TP53I13 Antibody, Novus Biologicals™
SDP

Rabbit Polyclonal Antibody

Host Species Rabbit
Conjugate Unconjugated
Applications Western Blot
Isotype IgG
Gene Accession No. NP_612358
Antigen TP53I13
Gene Symbols TP53I13
Regulatory Status RUO
Molecular Weight of Antigen 42 kDa
Gene Alias DSCP1Damage-stimulated cytoplasmic protein 1, tumor protein p53 inducible protein 13, tumor protein p53-inducible protein 13
Gene ID (Entrez) 90313
Immunogen Synthetic peptide directed towards the middle region of human TP53I13The immunogen for this antibody is TP53I13. Peptide sequence IYWGPTADSQDTVAAVLKRRLLQPSRRVKRSRRRPLLPPTPDSGPEGESS.
Classification Polyclonal
Primary or Secondary Primary