accessibility menu, dialog, popup

UserName
Viewing profile as user:
Abnova Corporation logo

Abnova Corporation

Designed for the clinical and in vitro diagnostic industries, Abnova products are manufactured in an ISO13485 and GMP-certified facility and an ISO15189 medical laboratory. They include rabbit monoclonal antibodies, ELISA kits, FISH probes, and CytoQuest™ CR systems.

Filtered Search Results

Products from some of our suppliers do not display in filtered search results. Please clear all filters to see these products.

Narrow Results

Narrow Results

category

special interests

  • (2)
  • (2)

Form

  • (1,898)
  • (969)
  • (69,845)
  • (2,227)
  • (2)
  • (1,917)
  • (1,337)
  • (7)
  • (3,316)
  • (1)

Host Species

  • (1)
  • (1)
  • (201)
  • (1)
  • (1)
  • (3)
  • (3,098)
  • (16)
  • (71)
  • (3,167)
  • (22,522)
  • (36,533)
  • (650)
  • (342)

Conjugate

  • (32)
  • (348)
  • (7)
  • (18)
  • (1)
  • (2)
  • (139)
  • (103)
  • (102)
  • (91)
  • (1,384)
  • (1)
  • (1)
  • (14)
  • (45)
  • (44)
  • (1)
  • (42)
  • (1)
  • (1)
  • (1)
  • (618)
  • (1)
  • (1)
  • (942)
  • (1)
  • (1)
  • (376)
  • (8)
  • (14)
  • (24)
  • (3)
  • (9)
  • (12)
  • (4)
  • (170)
  • (10)
  • (5)
  • (106)
  • (73)
  • (40)
  • (46)
  • (2)
  • (76)
  • (56,796)

Classification

  • (3)
  • (1)
  • (29,341)
  • (3,638)
  • (27,689)

Quantity

  • (2)
  • (1)
  • (3,647)
  • (383)
  • (909)
  • (10,955)
  • (4)
  • (136)
  • (4)
  • (5)
  • (10,379)
  • (21,200)
  • (797)
  • (1)
  • (1)
  • (4)
  • (4)
  • (1)
  • (3)
  • (242)
  • (64)
  • (99)
  • (357)
  • (70)
  • (19)
  • (1)
  • (1,239)
  • (778)
  • (1)
  • (1)
  • (87)
  • (18)
  • (44)
  • (1)
  • (2)
  • (4)
  • (2)
  • (104)
  • (1)
  • (4)
  • (1)
  • (34)
  • (1,716)
  • (2)
  • (1)
  • (12)
  • (3,645)
  • (2,596)
  • (52)
  • (14)
  • (167)
  • (646)
  • (1)
  • (1)

Applications

  • (35)
  • (34)
  • (148)
  • (26)
  • (1)
  • (468)
  • (33,738)
  • (6,180)
  • (99)
  • (9)
  • (4)
  • (2)
  • (29)
  • (4)
  • (17)
  • (3,099)
  • (42)
  • (9,321)
  • (4,955)
  • (75)
  • (1,216)
  • (12,183)
  • (3,239)
  • (15)
  • (5,574)
  • (1)
  • (4)
  • (798)
  • (58)
  • (123)
  • (204)
  • (2)
  • (1)
  • (2)
  • (5)
  • (1)
  • (328)
  • (33)
  • (1)
  • (44,901)

Target Species

  • (16)
  • (2)
  • (10)
  • (29)
  • (6)
  • (231)
  • (8)
  • (995)
  • (6)
  • (661)
  • (1)
  • (1)
  • (521)
  • (138)
  • (4)
  • (30)
  • (2)
  • (3)
  • (21)
  • (82)
  • (18)
  • (51)
  • (80)
  • (6)
  • (329)
  • (1)
  • (1)
  • (89)
  • (3)
  • (3)
  • (58)
  • (4)
  • (112)
  • (21)
  • (20)
  • (17)
  • (1)
  • (57)
  • (8)
  • (163)
  • (24)
  • (307)
  • (1)
  • (2)
  • (24)
  • (3)
  • (45)
  • (12)
  • (54,689)
  • (6)
  • (53)
  • (3)
  • (10)
  • (2)
  • (2)
  • (13)
  • (1)
  • (30)
  • (1)
  • (46)
  • (3)
  • (1)
  • (791)
  • (9,939)
  • (14)
  • (46)
  • (10)
  • (20)
  • (1)
  • (2)
  • (20)
  • (20)
  • (1)
  • (593)
  • (5)
  • (28)
  • (3)
  • (191)
  • (28)
  • (1)
  • (495)
  • (6,824)
  • (13)
  • (6)
  • (1)
  • (25)
  • (1)
  • (5)
  • (2)
  • (14)
  • (1)
  • (2)
  • (1)
  • (155)
  • (3)
  • (2)
  • (20)
  • (25)
  • (23)
  • (3)
  • (587)
  • (42)
  • (129)
  • (86)

Regulatory Status

  • (55,361)

Isotype

  • (6)
  • (6)
  • (6)
  • (3)
  • (3)
  • (11)
  • (22,532)
  • (184)
  • (12)
  • (2)
  • (4,705)
  • (3,869)
  • (50)
  • (2)
  • (24)
  • (7)
  • (3)
  • (1,230)
  • (2,518)
  • (28)
  • (7)
  • (1)
  • (801)
  • (1,275)
  • (20)
  • (6)
  • (15)
  • (24)
  • (4)
  • (103)
  • (1)
  • (146)
  • (7)
  • (8)
  • (1)
  • (1)
  • (1)
  • (231)
  • (357)
  • (1)
  • (152)
  • (1)

For Use With (Application)

  • (1)
  • (23,546)
  • (1)
  • (2)
  • (254)
  • (1)
  • (4)
  • (23,650)
  • (104)
  • (2)
  • (4)
  • (23)
  • (1,371)
  • (1)
  • (1)
  • (4)
  • (2)
  • (1)
  • (65)
  • (3)
  • (23,576)
  • (63)
  • (1,585)
  • (23,674)

1 – 15 of 82,491 results
1

Precious Metals, plasma standard solution, Specpure™, Au, Ir, Os, Pd, Pt, Re, Rh, Ru @ 100μg/mL

Solubility Miscible with water
Physical Form Liquid
UN Number UN1789
Chemical Name or Material Precious Metals, plasma standard solution
Grade Specpure™
Concentration Matrix: 20% HCl
Name Note Au, Ir, Os, Pd, Pt, Re, Rh, Ru @ 100μg/mL
MDL Number MFCD00151264
Health Hazard 2 May cause respiratory irritation, May be corrosive to metals, Causes severe skin burns and eye damage
Health Hazard 1 Specific target organ toxicity after single exposure (category 3), Corrosive to metals (category 1), Skin corrosion/irritation (category 1)
DOT Information Transport Hazard Class: 8; Packing Group: II; Proper Shipping Name: HYDROCHLORIC ACID
TSCA Yes
Recommended Storage Ambient temperatures
EINECS Number 231-595-7
2

Calcium bromide hydrate, 95%

CAS: 71626-99-8 Molecular Formula: Br2Ca Molecular Weight (g/mol): 199.89 MDL Number: MFCD00149608 InChI Key: WGEFECGEFUFIQW-UHFFFAOYSA-L IUPAC Name: calcium dibromide SMILES: [Ca++].[Br-].[Br-]

CAS 71626-99-8
Molecular Weight (g/mol) 199.89
MDL Number MFCD00149608
SMILES [Ca++].[Br-].[Br-]
IUPAC Name calcium dibromide
InChI Key WGEFECGEFUFIQW-UHFFFAOYSA-L
Molecular Formula Br2Ca
3

F-box protein 15/FBXO15 Antibody [Janelia Fluor™ 669], Novus Biologicals™
SDP

Sheep Polyclonal Antibody

Content And Storage Store at 4°C in the dark.
Target Species Human
Host Species Sheep
Conjugate Janelia Fluor 669
Applications Western Blot
Form Purified
Isotype IgG
Antigen F-box protein 15/FBXO15
Regulatory Status RUO
Purification Method Antigen Affinity-purified
Gene Alias F-box only protein 15, F-box protein 15, FBX15MGC39671
Gene ID (Entrez) 201456
Formulation 50mM Sodium Borate
Classification Polyclonal
Immunogen E. coli-derived recombinant human F-box protein 15/FBXO15, aa 298-434, Accession # NP_689889
Primary or Secondary Primary
4

wnvNS3 Protease Antibody [DyLight 650], Novus Biologicals™
SDP

Goat Polyclonal Antibody

Content And Storage Store at 4°C in the dark.
Target Species Virus
Host Species Goat
Conjugate DyLight 650
Applications Immunoprecipitation,Western Blot
Form Purified
Isotype IgG
Antigen wnvNS3 Protease
Regulatory Status RUO
Purification Method Antigen Affinity-purified
Gene ID (Entrez) 912267
Formulation 50mM Sodium Borate
Classification Polyclonal
Immunogen E. coli-derived recombinant wnvNS3 Protease, expressed as a fusion protein with cofactor NS2L, Gly1506-Leu1689, Accession # ABD85079
Primary or Secondary Primary
7

Abnova™ Human FBXO27 Full-length ORF (NP_849142.1, 1 a.a. - 283 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Form Liquid
Common Name FBXO27
Molecular Weight (g/mol) 58kDa
Gene Symbol FBXO27
Storage Requirements Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Expression System wheat germ expression system
For Use With (Application) Antibody Production,Protein Array,ELISA,Western Blot
Name FBXO27 (Human) Recombinant Protein (P01)
Accession Number NP_849142.1
Regulatory Status RUO
Purification Method Glutathione Sepharose 4 Fast Flow
Gene Alias FBG5/Fbx27
Gene ID (Entrez) 126433
Formulation 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Immunogen MGASVSRGRAARVPAPEPEPEEALDLSQLPPELLLVVLSHVPPRTLLGRCRQVCRGWRALVDGQALWLLILARDHGATGRALLHLARSCQSPARNARPCPLGRFCARRPIGRNLIRNPCGQEGLRKWMVQHGGDGWVVEENRTTVPGAPSQTCFVTSFSWCCKKQVLDLEEEGLWPELLDSGRIEICVSDWWGARHDSGCMYRLLVQLLDANQTVLDKFSAVPDPIPQWNNNACLHVTHVFSNIKMGVRFVSFEHRGQDTQFWAGHYGARVTNSSVIVRVRLS
Quality Control Testing 12.5% SDS-PAGE Stained with Coomassie Blue.
Protein Tag GST
Species Wheat Germ (in vitro)
Recombinant Recombinant
9

Abnova Corporation TP53 (phospho S20), Rabbit anti-Human, Polyclonal Antibody, Abnova™

Rabbit polyclonal antibody raised against synthetic phosphopeptide of TP53.

10

Abnova Corporation PKMYT1 (phospho T495), Rabbit anti-Human, Polyclonal Antibody, Abnova™

Rabbit polyclonal antibody raised against synthetic phosphopeptide of PKMYT1.

11

Abnova Corporation ERBB4 (phospho Y1162), Rabbit anti-Human, Polyclonal Antibody, Abnova™

Rabbit polyclonal antibody raised against synthetic phosphopeptide of ERBB4.

12

Abnova™ Human FPR2 Partial ORF (AAH29125.1, 163 a.a. - 205 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Form Liquid
Common Name FPR2
Molecular Weight (g/mol) 30.36kDa
Gene Symbol FPR2
Storage Requirements Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Expression System wheat germ expression system
For Use With (Application) Antibody Production,ELISA,Protein Array,Western Blot
Name FPR2 (Human) Recombinant Protein (Q01)
Accession Number AAH29125.1
Regulatory Status RUO
Gene Alias ALXR/FMLP-R-II/FMLPX/FPR2A/FPRH1/FPRH2/FPRL1/HM63/LXA4R
Gene ID (Entrez) 2358
Formulation 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Immunogen FLTTVTIPNGDTYCTFNFASWGGTPEERLKVAITMLTARGIIR
Quality Control Testing 12.5% SDS-PAGE Stained with Coomassie Blue.
Protein Tag GST
Species Wheat Germ (in vitro)
Recombinant Recombinant
13

Abnova™ Human FOXP4 Full-length ORF (NP_001012427.1, 1 a.a. - 678 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Form Liquid
Common Name FOXP4
Molecular Weight (g/mol) 99.6kDa
Gene Symbol FOXP4
Storage Requirements Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Expression System wheat germ expression system
For Use With (Application) Antibody Production,Protein Array,ELISA,Western Blot
Name FOXP4 (Human) Recombinant Protein (P01)
Accession Number NP_001012427.1
Regulatory Status RUO
Purification Method Glutathione Sepharose 4 Fast Flow
Gene Alias FLJ40908/FLJ44184/hFKHLA
Gene ID (Entrez) 116113
Formulation 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Immunogen MMVESASETIRSAPSGQNGVGSLSGQADGSSGGATGTTASGTGREVTTGADSNGEMSPAELLHFQQQQALQVARQFLLQQASGLSSPGNNDSKQSASAVQVPVSVAMMSPQMLTPQQMQQILSPPQLQALLQQQQALMLQQEYYKKQQEQLHLQLLTQQQAGKPQPKEALGNKQLAFQQQLLQMQQLQQQHLLNLQRQGLVSLQPNQASGPLQTLPQAAVCPTDLPQLWKGEGAPGQPAEDSVKQEGLDLTGTAATATSFAAPPKVSPPLSHHTLPNGQPTVLTSRRDSSSHEETPGSHPLYGHGECKWPGCETLCEDLGQFIKHLNTEHALDDRSTAQCRVQMQVVQQLEIQLAKESERLQAMMAHLHMRPSEPKPFSQPLNPVPGSSSFSKVTVSAADSFPDGLVHPPTSAAAPVTPLRPPGLGSASLHGGGPARRRSSDKFCSPISSELAQNHEFYKNADVRPPFTYASLIRQAILETPDRQLTLNEIYNWFTRMFAYFRRNTATWKNAVRHNLSLHKCFVRVENVKGAVWTVDEREYQKRRPPKMTGSPTLVKNMISGLSYGALNASYQAALAESSFPLLNSPGMLNPGSASSLLPLSHDDVGAPVEPLPSNGSSSPPRLSPPQYSHQVQVKEEPAEAEEDRQPGPPLGAPNPSASGPPEDRDLEEELPGEELS
Quality Control Testing 12.5% SDS-PAGE Stained with Coomassie Blue.
Protein Tag GST
Species Wheat Germ (in vitro)
Recombinant Recombinant
14

Abnova™ Human FSHR Partial ORF (NP_000136, 18 a.a. - 120 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Form Liquid
Common Name FSHR
Molecular Weight (g/mol) 37.07kDa
Gene Symbol FSHR
Storage Requirements Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Expression System wheat germ expression system
For Use With (Application) Antibody Production,ELISA,Protein Array,Western Blot
Name FSHR (Human) Recombinant Protein (Q01)
Accession Number NP_000136
Regulatory Status RUO
Gene Alias FSHRO/LGR1/MGC141667/MGC141668/ODG1
Gene ID (Entrez) 2492
Formulation 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Immunogen CHHRICHCSNRVFLCQESKVTEIPSDLPRNAIELRFVLTKLRVIQKGAFSGFGDLEKIEISQNDVLEVIEADVFSNLPKLHEIRIEKANNLLYINPEAFQNLP
Quality Control Testing 12.5% SDS-PAGE Stained with Coomassie Blue.
Protein Tag GST
Species Wheat Germ (in vitro)
Recombinant Recombinant
15

Abnova™ Human PURG Full-length ORF (NP_037489.1, 1 a.a. - 347 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Form Liquid
Common Name PURG
Molecular Weight (g/mol) 66kDa
Gene Symbol PURG
Storage Requirements Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Expression System wheat germ expression system
For Use With (Application) Antibody Production,Protein Array,ELISA,Western Blot
Name PURG (Human) Recombinant Protein (P01)
Accession Number NP_037489.1
Regulatory Status RUO
Purification Method Glutathione Sepharose 4 Fast Flow
Gene Alias MGC119274/PURG-A/PURG-B
Gene ID (Entrez) 29942
Formulation 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Immunogen MERARRRGGGGGRGRGGKNVGGSGLSKSRLYPQAQHSHYPHYAASATPNQAGGAAEIQELASKRVDIQKKRFYLDVKQSSRGRFLKIAEVWIGRGRQDNIRKSKLTLSLSVAAELKDCLGDFIEHYAHLGLKGHRQEHGHSKEQGSRRRQKHSAPSPPVSVGSEEHPHSVLKTDYIERDNRKYYLDLKENQRGRFLRIRQTMMRGTGMIGYFGHSLGQEQTIVLPAQGMIEFRDALVQLIEDYGEGDIEERRGGDDDPLELPEGTSFRVDNKRFYFDVGSNKYGIFLKVSEVRPPYRNTITVPFKAWTRFGENFIKYEEEMRKICNSHKEKRMDGRKASGEEQECLD
Quality Control Testing 12.5% SDS-PAGE Stained with Coomassie Blue.
Protein Tag GST
Species Wheat Germ (in vitro)
Recombinant Recombinant