Novus Biologicals

Browse a range of Novus Biologicals antibodies, proteins, stains, kits, research reagents, and other products to support your scientific needs.

Narrow Results

Classification

Monoclonal (447,342)
Polyclonal (375,531)

Regulatory Status

RUO (751,522)

1 – 15 of 868,618 results

His Tag Antibody (HIS.H8), Alexa Fluor™ 700, Novus Biologicals™

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4C in the dark.
Target Species	Tag
Host Species	Mouse
Conjugate	Alexa Fluor 700
Applications	Western Blot,Western Blot,Flow Cytometry,ELISA,Immunocytochemistry
Form	Purified
Isotype	IgG2b
Research Discipline	Cellular Markers, Epitope Tags
Antigen	His Tag
Regulatory Status	RUO
Purification Method	Protein A or G purified
Dilution	Western Blot, Simple Western, Flow Cytometry, ELISA, Immunocytochemistry/ Immunofluorescence, Immunoprecipitation, CyTOF-ready
Gene Alias	6 His epitope tag, 6-His Tag, 6X His, 6X His Tag, 6X-His, 6x-His Tag, H, Hexa His tag, HHHHHH epitope tag, HHHHHH tag, HIS, His tag, His6-Tag, polyHistidine, Poly-histidine, polyhistidine tag
Formulation	50mM Sodium Borate
Classification	Monoclonal
Immunogen	This His Tag Antibody (HIS.H8) was developed against a 6x His synthetic peptide.
Primary or Secondary	Primary
Clone	HIS.H8

p62/SQSTM1 Antibody (2533B) - BSA Free, Novus Biologicals™

Rabbit Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Target Species	Human
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Western Blot,Simple Western,Immunohistochemistry,Immunofluorescence,Immunohistochemistry (Paraffin)
Form	Purified
Research Discipline	Adaptive Immunity, Cancer, Chromatin Modifiers, Chromatin Research, DNA Methyltransferases, Epigenetics, Innate Immunity, Tumor Suppressors
Concentration	1.0 mg/mL
Antigen	p62/SQSTM1
Regulatory Status	RUO
Purification Method	Protein A or G purified
Dilution	Western Blot 1 μg/ml, Simple Western 20 μg/ml, Immunohistochemistry 8-25 μg/ml, Immunocytochemistry/ Immunofluorescence 8-25 μg/ml, Immunohistochemistry-Paraffin 8-25 μg/ml, Knockout Validated
Gene Alias	A170, Autophagy Receptor P62, DMRV, EBI3-associated protein of 60 kDa, EBI3-associated protein p60, EBIAP, FTDALS3, NADGP, ORCA, OSIL, oxidative stress induced like, p60PDB3, p62, p62B, Paget disease of bone 3, PDB3, phosphotyrosine independent ligand for the Lck SH2 domain p62, Phosphotyrosine-independent ligand for the Lck SH2 domain of 62 kDa, sequestosome 1, sequestosome-1, Ubiquitin-binding protein p62, ZIP3
Gene ID (Entrez)	8878
Formulation	PBS
Immunogen	Partial recombinant human p62/SQSTM1 protein produced in E. coli (amino acids 368-440) [UniProt Q13501]
Classification	Monoclonal
Primary or Secondary	Primary
Clone	2533B

Novus Biologicals™ DAPI Solution

Applications: Flow Cytometry, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Immunohistochemistry-Frozen, Immunohistochemistry Free-Floating, Immunohistochemistry Whole-Mount, Immunofluorescence, Immunocytochemistry

Pricing & Availability

Novus Biologicals™ COOMASSIEnano Protein Staining Solution

Ready-to-use protein staining solution for SDS-PAGE gels

Pricing & Availability

Vinculin Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Target Species	Human
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Western Blot,Immunocytochemistry,Immunofluorescence,KnockDown
Isotype	IgG
Research Discipline	Cellular Markers, Cytoskeleton Markers
Antigen	Vinculin
Gene Symbols	VCL
Regulatory Status	RUO
Purification Method	Affinity Purified
Gene Alias	CMD1W, CMH15, Metavinculin, MVCL, vinculin
Gene ID (Entrez)	7414
Formulation	PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Immunogen	This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:SALTSKLADLRRQGKGDSPEARALAKQVATALQNLQTKTNRAVANSRPAKAAVHLEGKIEQAQRWIDNPTVDDRGVGQAAIRGLVAEGHRLANVMMGP
Classification	Polyclonal
Primary or Secondary	Primary
Test Specificity	Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

Goat anti-Rabbit IgG (H+L) Secondary Antibody, HRP, Novus Biologicals™

Goat Polyclonal Antibody has been used in 23 publications

Pricing & Availability

Novus Biologicals™ Human alpha-Smooth Muscle Actin ELISA Kit (Chemiluminescence)

ELISA kits are ideal for the quantification of target antigens in tissue extracts, serum and cell culture.

Pricing & Availability

Goat anti-Monkey IgM Heavy Chain Secondary Antibody, HRP, Novus Biologicals™

Goat Polyclonal Antibody

Pricing & Availability

Novus Biologicals™ Red Blood Cell (RBC) Lysis Buffer

Applications: Functional

Pricing & Availability

Fibroblast Activation Protein alpha/FAP Antibody (sibrotuzumab) - Humanized, Novus Biologicals™

Human Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at -20°C in powder form. Store at -80°C once reconstituted.
Target Species	Human
Host Species	Human
Conjugate	Unconjugated
Applications	Flow Cytometry,ELISA,Functional Assay
Form	Purified
Isotype	IgG1
Gene Accession No.	Q12884
Research Discipline	Cancer, Protein Phosphatase
Antigen	Fibroblast Activation Protein alpha/FAP
Regulatory Status	RUO
Purification Method	Protein A purified
Gene Alias	170 kDa melanoma membrane-bound gelatinase, DKFZp686G13158, DPPIV, EC 3.4.21.-, FAPA, Fibroblast activation protein alpha, fibroblast activation protein, alpha, Integral membrane serine protease, seprase, vibronectin
Gene ID (Entrez)	2191
Formulation	Lyophilized from 25mM histidine, 8% sucrose, 0.01% Tween80 (pH6.2)
Immunogen	FAP
Classification	Monoclonal
Reconstitution	Reconstitute with sterile, distilled water to a final concentration of 1 mg/mL. Gently shake to solubilize completely. Do not vortex.
Primary or Secondary	Primary
Clone	sibrotuzumab

beta-Actin Antibody (BLR057F), Novus Biologicals™

Rabbit Monoclonal Antibody

Pricing & Availability

RBFOX3/NeuN Antibody (1B7), Alexa Fluor™ 647, Novus Biologicals™

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4C in the dark.
Conjugate	Alexa Fluor 647
Target Species	Human,Mouse,Rat
Host Species	Mouse
Applications	Western Blot,Flow Cytometry,Immunohistochemistry,Immunocytochemistry,Immunofluorescence,Immunohistochemistry (Paraffin),Immunohistochemistry (Frozen)
Form	Purified
Isotype	IgG2b κ
Antigen	RBFOX3/NeuN
Regulatory Status	RUO
Purification Method	Protein G purified
Gene Alias	FLJ56884, FLJ58356, Fox-1 homolog C, FOX3, FOX-3, hexaribonucleotide binding protein 3, HRNBP3, NeuN, neuronal nuclei, RBFOX3, RNA binding protein fox-1 homolog 3, RNA binding protein, fox-1 homolog (C. elegans) 3
Gene ID (Entrez)	146713
Classification	Monoclonal
Immunogen	N-terminal 99 amino acids of human FOX3 as expressed in and purified from E. coli
Primary or Secondary	Primary
Clone	1B7

Novus Biologicals™ Alpha Amylase Activity Assay Kit (Colorimetric)

Assay Kit (Colorimetric)

Pricing & Availability

Novus Biologicals™ Mouse HMGB1/HMG-1 ELISA Kit (Colorimetric)

ELISA kits are ideal for the quantification of target antigens in tissue extracts, serum and cell culture.

Pricing & Availability

Novus Biologicals™ Sheep Progesterone ELISA Kit (Colorimetric)

Sheep Progesterone ELISA Kit (Colorimetric) employs competitive ELISA technique for detection of Sheep Progesterone

Pricing & Availability
Specifications

Target	Progesterone
Product Type	ELISA Kit (Colorimetric)
Sample Type	Plasma,Serum,Tissue Homogenates
Sample Volume	50 to 100 μL
Synonym	Pregn 4 ene 3 20 dione
Assay Sensitivity	0.2ng/mL
Assay Range	0.4ng/mL to 30ng/mL
Storage Requirements	Store at 4°C
Research Discipline	Signal Transduction
For Use With (Application)	ELISA

Prev
1
2
3
4
5
6
...
57,908
Next

Novus Biologicals

Filtered Search Results

Narrow Results

His Tag Antibody (HIS.H8), Alexa Fluor™ 700, Novus Biologicals™ Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

p62/SQSTM1 Antibody (2533B) - BSA Free, Novus Biologicals™ Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ DAPI Solution Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ COOMASSIEnano Protein Staining Solution Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Vinculin Antibody, Novus Biologicals™ Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Goat anti-Rabbit IgG (H+L) Secondary Antibody, HRP, Novus Biologicals™ Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ Human alpha-Smooth Muscle Actin ELISA Kit (Chemiluminescence) Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Goat anti-Monkey IgM Heavy Chain Secondary Antibody, HRP, Novus Biologicals™ Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ Red Blood Cell (RBC) Lysis Buffer Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Fibroblast Activation Protein alpha/FAP Antibody (sibrotuzumab) - Humanized, Novus Biologicals™ Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

beta-Actin Antibody (BLR057F), Novus Biologicals™ Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

RBFOX3/NeuN Antibody (1B7), Alexa Fluor™ 647, Novus Biologicals™ Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ Alpha Amylase Activity Assay Kit (Colorimetric) Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ Mouse HMGB1/HMG-1 ELISA Kit (Colorimetric) Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ Sheep Progesterone ELISA Kit (Colorimetric) Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More