Recombinant Proteins
- (2)
- (970)
- (1)
- (23,544)
- (5)
- (1)
- (1)
- (67)
- (219)
- (4,425)
- (23)
- (1)
- (4)
- (2)
- (13)
- (21,464)
- (3)
- (4)
- (3)
- (1)
- (2)
- (4)
- (14)
- (71)
- (2)
- (2)
- (2)
- (1)
- (3)
- (2)
- (1)
- (3)
- (4)
- (1)
- (1)
- (1)
- (3)
- (254)
- (22,607)
- (1)
- (1)
- (2)
- (1)
- (13)
- (26,167)
- (266)
- (32)
- (3)
- (708)
- (14)
- (2)
- (1)
- (8)
- (1)
- (5)
- (1)
- (108)
- (1)
- (3,783)
- (1,408)
- (3)
- (4)
- (2)
- (5)
- (1)
- (1)
- (1)
- (1)
- (14)
- (137)
- (48)
- (6)
- (17)
- (2)
- (1)
- (4)
- (82)
- (12)
- (2)
- (3)
- (80)
- (4)
- (113)
- (96)
- (19)
- (1)
- (1)
- (4)
- (1)
- (1,525)
- (2)
- (1)
- (3)
- (18)
- (48)
- (3)
- (1)
- (2)
- (9)
- (27)
- (2)
- (198)
- (1)
- (4)
- (1)
- (2)
- (114)
- (44)
- (2)
- (1)
- (1)
- (4)
- (1)
- (1)
- (3)
- (1)
- (23,710)
- (6)
- (3)
- (1)
- (1)
- (63)
- (6)
- (2)
- (7)
- (5)
- (1)
- (2)
- (1)
- (1)
- (6,726)
- (6)
- (4)
- (1)
- (3)
- (1)
- (3)
- (2)
- (13)
- (17)
- (1)
- (3)
- (3)
- (4)
- (25,927)
- (240)
- (1)
- (3)
- (286)
- (2)
- (61,760)
- (1)
- (15)
- (1)
- (2)
- (45,220)
- (5,704)
- (245)
- (168)
- (56)
- (3,364)
- (2)
- (1)
- (2)
- (1)
- (21)
- (559)
- (96)
- (2)
- (1)
- (1)
- (2)
- (1)
- (27)
- (1)
- (8)
- (15)
- (1)
- (72)
- (1)
- (1,050)
- (1)
- (3)
- (16)
- (1)
- (3)
- (1)
- (1)
- (1)
- (8)
- (1)
- (4)
- (1)
- (1)
- (26,023)
- (5)
- (1)
- (4)
- (582)
- (2)
- (1)
- (1)
- (3)
- (1)
- (1)
- (14)
- (32)
- (24)
- (1)
- (2)
- (16)
- (120)
- (9)
- (2)
- (1)
- (2)
- (2)
- (2)
- (23)
- (5)
- (3)
- (3)
- (2)
- (14)
- (23,575)
- (1)
- (48)
- (7)
- (1)
- (3)
- (18)
- (2)
- (62)
- (1)
- (4)
- (2)
- (9)
- (59)
- (1)
- (2)
- (3)
- (1)
- (391)
- (1)
- (3)
- (2)
- (1)
- (1)
- (1)
- (3)
- (2)
- (6)
- (19)
- (7)
- (2)
- (2)
- (3)
- (45)
- (1)
- (1)
- (1)
- (2)
- (5)
- (1)
- (1)
- (1)
- (1)
- (2)
- (8)
- (2)
- (3)
- (38,961)
- (1)
- (11)
Filtered Search Results
Novus Biologicals™ GMPR2 Protein
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Highly purified. Generating reliable and reproducible results.
| Regulatory Status | RUO |
|---|---|
| Purification Method | Protein |
| Purity or Quality Grade | >90% |
| Conjugate | Unconjugated |
| Common Name | GMPR2 |
| Molecular Weight (g/mol) | 40kDa |
| Gene ID (Entrez) | 51292 |
| Formulation | Liquid. In 20mM Tris-HCl buffer (pH 8.0) containing 1mM DTT, 10% glycerol |
| Immunogen | GMPR2, 1- 348 aa. Sequence: MGSSHHHHHHSSGLVPRGSHMPHIDNDVKLDFKDVLLRPKRSTLKSRSEVDLTRSFSFRNSKQTYSGVPIIAANMDTVGTFEMAKVLCKFSLFTAVHKHYSLVQWQEFAGQNPDCLEHLAASSGTGSSDFEQLEQILEAIPQVKYICLDVANGYSEHFVEFVKDVRKRFPQHTIMAGNVVTGEMVEELILSGADIIKVGIGPGSVCTTRKKTGVGYPQLSAVMECADAAHGLKGHIISDGGCSCPGDVAKAFGAGADFVMLGGMLAGHSESGGELIERDGKKYKLFYGMSSEMAMKKYAGGVAEYRASEGKTVEVPFKGDVEHTIRDILGGIRSTCTYVGAAKLKELSRRTTFIRVTQQVNPIFSEAC |
| Storage Requirements | Store at -80°C. Avoid freeze-thaw cycles. |
| Concentration | 1mg/mL |
| For Use With (Application) | ELISA,SDS-PAGE |
| Source | Human |
Novus Biologicals™ Recombinant Human PLA1A His Protein
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Highly purified. Generating reliable and reproducible results. Applications: SDS-Page
| Purity or Quality Grade | >80%, by SDS-PAGE under reducing conditions and visualized by Colloidal Coomassie™ Blue stain |
|---|---|
| Conjugate | Unconjugated |
| Gene Alias | EC 3.1.1, EC 3.1.1.-, NMD, phosphatidylserine-specific phospholipase A1alpha, phospholipase A1 member A, PS-PLA1, PSPLA1Phosphatidylserine-specific phospholipase A1 |
| Common Name | PLA1A |
| Molecular Weight (g/mol) | TMW: 49.5kDa |
| Gene ID (Entrez) | 51365 |
| Formulation | 20mM Tris-HCl buffer (pH 8.0) containing 0.4M UREA, 10% glycerol |
| Storage Requirements | Store at 4°C short term. Aliquot and store at −20°C long term. Avoid freeze-thaw cycles. |
| Concentration | 1mg/mL |
| For Use With (Application) | SDS-PAGE |
| Recombinant | Recombinant |
Novus Biologicals™ Recombinant SARS-CoV-2 Spike RBD (N501Y) His Avi-tag Protein
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Recombinant Protein
Novus Biologicals™ Recombinant Mouse STI1 His Protein
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Highly purified. Generating reliable and reproducible results.
| Conjugate | Unconjugated |
|---|---|
| Molecular Weight (g/mol) | 64.7 kDa |
| Gene Symbol | STIP1 |
| Storage Requirements | Store at 4°C short term. Aliquot and store at −20°C long term. Avoid freeze-thaw cycles. |
| Concentration | 1mg/mL |
| For Use With (Application) | SDS-PAGE |
| Source | E.coli |
| Name | Recombinant Mouse STI1 Protein |
| Regulatory Status | RUO |
| Purification Method | >90%, by SDS-PAGE |
| Gene Alias | Hop, HOPSTI1L, Hsc70/Hsp90-organizing protein, Hsp70/Hsp90-organizing protein, IEF-SSP-3521, NY-REN-11 antigen, Renal carcinoma antigen NY-REN-11, STI1P60, stress-induced-phosphoprotein 1, Transformation-sensitive protein IEF SSP 3521 |
| Product Type | Recombinant Protein |
| Gene ID (Entrez) | 10963 |
| Formulation | Liquid. 20mM Tris-HCl(pH8.0) containing 0.1M NaCl, 1mM DTT, 10% glycerol |
| Cross Reactivity | Mouse |
| Recombinant | Recombinant |
R&D Systems™ Recombinant Mouse Semaphorin 4B Fc Chimera Protein
Measured by its ability to enhance neurite outgrowth of E16-E18 rat embryonic cortical neurons. Recombinant Mouse Semaphorin 4B Fc Chimera, immobilized at 2.5 μg/mL on a 96 well plate, is able to significantly enhance neurite outgrowth.
Novus Biologicals™ Recombinant SARS-CoV-2 NSP13 His (C-Term) Protein
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Recombinant Protein
Gibco™ Human IL-1 alpha Recombinant Protein
Recombinant Protein
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
| Shipping Condition | Approved for shipment on Wet or Dry Ice |
|---|---|
| Protein Family | Cytokines & Receptors |
| Form | Lyophilized |
| Protein Form | Recombinant, Ligand |
| Gene ID (Entrez) | 3552 |
| Classification | Carrier-Free |
| Research Category | Cell Cycle & Proliferation, Immunology, Angiogenesis |
| Expression System | E. coli |
| Species | Human |
| Product Line | Gibco |
| Protein Subtype | Interleukins |
| Recombinant | Recombinant |
Gibco™ Human IL-17A Recombinant Protein
Recombinant Protein
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
| Purity or Quality Grade | ≥98% by SDS-PAGE and HPLC |
|---|---|
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Molecular Weight (g/mol) | 31 kDa |
| Common Name | IL-17A |
| Gene Symbol | IL17A |
| Activity | ED50 = 0.5 - 5.0 ng/mL; determined by the dose-dependent production of GRO-alpha by HT-29 cells. |
| Endotoxin Concentration | <1 ng/μg |
| Storage Requirements | -20°C |
| Sequence | Human IL-17A recombinant protein is homodimeric containing two 137 amino acid subunits |
| Expression System | E. coli |
| For Use With (Application) | Bioactivity |
| Name | Human IL-17A |
| Accession Number | Q16552 |
| Regulatory Status | RUO |
| Purification Method | Purified |
| Gene Alias | Ctla8; CTLA-8; cytokine; cytotoxic T-lymphocyte-associated antigen 8; cytotoxic T-lymphocyte-associated protein 8; il 17; Il17; IL-17; IL17A; IL-17a; ILN; Interleukin; interleukin 17; interleukin 17 (cytotoxic T-lymphocyte-associated serine esterase 8); interleukin 17 precursor; interleukin 17A; interleukin-17; Interleukin17A; interleukin-17A; R-IL-17-A |
| Product Type | Protein |
| Gene ID (Entrez) | 3605 |
| Formulation | Protein with no preservative |
| Recombinant | Recombinant |
Novus Biologicals™ Recombinant Human CD37 His Protein
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Highly purified. Generating reliable and reproducible results. Applications: SDS-Page
| Purity or Quality Grade | >90%, by SDS-PAGE under reducing conditions and visualized by Colloidal Coomassie™ Blue stain |
|---|---|
| Conjugate | Unconjugated |
| Gene Alias | CD37 antigentetraspanin-26, CD37 molecule, cell differentiation antigen 37, GP52-40, leukocyte antigen CD37, MGC120234, Tetraspanin-26, Tspan-26, TSPAN26leukocyte surface antigen CD37 |
| Common Name | CD37 |
| Molecular Weight (g/mol) | TMW: 17.4kDa |
| Gene ID (Entrez) | 951 |
| Formulation | Phosphate buffer saline(pH 7.4) containing 10% glycerol |
| Storage Requirements | Store at 4°C short term. Aliquot and store at −20°C long term. Avoid freeze-thaw cycles. |
| Concentration | 1mg/mL |
| For Use With (Application) | SDS-PAGE |
| Recombinant | Recombinant |
R&D Systems™ Recombinant Human BTN1A1/Butyrophilin Protein
Learn More About B7-related Butryophilins as Immune Modulators View Webinar
Novus Biologicals™ Recombinant Human NKIRAS2 His Protein
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Highly purified. Generating reliable and reproducible results.
Novus Biologicals™ ECHDC1 Protein
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Highly purified. Generating reliable and reproducible results.
| Regulatory Status | RUO |
|---|---|
| Purification Method | SDS-PAGE |
| Purity or Quality Grade | >95% |
| Conjugate | Unconjugated |
| Common Name | ECHDC1 |
| Storage Requirements | Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| For Use With (Application) | SDS-PAGE |
| Source | Human |