Recombinant Proteins

Modified or manipulated proteins encoded by recombinant DNA and suitable for a variety of purposes including the modification of gene sequences, mass protein production, and the manufacture of commercial products.

Search Within Results

2,986 – 3,000 of 127,599 results

2,986

Novus Biologicals™ Recombinant Human MEIS1 GST (N-Term) Protein

Recombinant Protein

Pricing & Availability
Specifications

Purity or Quality Grade	>80% by SDS-PAGE and Coomassie blue staining
Gene Alias	homeobox protein Meis1, leukemogenic homolog protein, Meis homeobox 1, MGC43380, myeloid ecotropic viral integration site 1 homolog, myeloid ecotropic viral integration site 1 homolog (mouse)
Molecular Weight (g/mol)	35.64 kDa
Gene ID (Entrez)	4211
Formulation	50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Gene Symbol	MEIS1
Storage Requirements	Store at -80°C. Avoid freeze-thaw cycles.
For Use With (Application)	Western Blot,ELISA,Protein Array,Immunoaffinity Purification
Protein	MEIS1

2,987

Novus Biologicals™ Recombinant Human MBTPS1 GST (N-Term) Protein

Recombinant Protein

Pricing & Availability
Specifications

Purity or Quality Grade	>80% by SDS-PAGE and Coomassie blue staining
Gene Alias	EC 3.4.21.112, Endopeptidase S1P, KIAA0091MGC138712, membrane-bound transcription factor peptidase, site 1, membrane-bound transcription factor protease, site 1, PCSK8, S1PMGC138711, site-1 protease, SKI1, SKI-1membrane-bound transcription factor site-1 protease, subtilisin/kexin isozyme-1, Subtilisin/kexin-isozyme 1
Molecular Weight (g/mol)	37.84 kDa
Gene ID (Entrez)	8720
Formulation	50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Gene Symbol	MBTPS1
Research Category	Cell Biology, Endocrinology, Signal Transduction
Storage Requirements	Store at -80°C. Avoid freeze-thaw cycles.
For Use With (Application)	Western Blot,ELISA,Protein Array,Immunoaffinity Purification
Protein	MBTPS1

2,988

Novus Biologicals™ Recombinant Human Niemann-Pick C1 GST (N-Term) Protein

Recombinant Protein

Pricing & Availability
Specifications

Purity or Quality Grade	>80% by SDS-PAGE and Coomassie blue staining
Gene Alias	FLJ98532, Niemann-Pick C1 protein, Niemann-Pick disease, type C1, NPC, NPC1
Molecular Weight (g/mol)	36.63 kDa
Gene ID (Entrez)	4864
Formulation	50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Gene Symbol	NPC1
Research Category	Lipid and Metabolism, Neurodegeneration, Neuronal Cell Markers
Storage Requirements	Store at -80°C. Avoid freeze-thaw cycles.
For Use With (Application)	Western Blot,ELISA,Protein Array,Immunoaffinity Purification
Protein	Niemann-Pick C1

2,989

Invitrogen™ Human B3GNT4 (aa 60-125) Control Fragment Recombinant Protein

Recombinant Protein

Pricing & Availability

2,990

R&D Systems™ Recombinant SARS-CoV-2 F486V Spike RBD His-tag Protein

Pricing & Availability

2,991

Novus Biologicals™ Recombinant Human OSBPL3 GST (N-Term) Protein

Recombinant Protein

Pricing & Availability
Specifications

Purity or Quality Grade	>80% by SDS-PAGE and Coomassie blue staining
Gene Alias	DKFZp667P1518, KIAA0704ORP3ORP-3OSBP3, MGC21526, OSBP-related protein 3, oxysterol binding protein-like 3, oxysterol-binding protein 3, oxysterol-binding protein-related protein 3
Molecular Weight (g/mol)	120.2 kDa
Gene ID (Entrez)	26031
Formulation	50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Gene Symbol	OSBPL3
Storage Requirements	Store at -80°C. Avoid freeze-thaw cycles.
For Use With (Application)	Western Blot,ELISA,PAGE,Protein Array,Immunoaffinity Purification
Protein	OSBPL3

2,992

Novus Biologicals™ Recombinant Human LHX2 GST (N-Term) Protein

Recombinant Protein

Pricing & Availability
Specifications

Purity or Quality Grade	>80% by SDS-PAGE and Coomassie blue staining
Gene Alias	hLhx2, Homeobox protein LH-2, LH-2, LH2MGC138390, LIM homeobox 2, LIM homeobox protein 2, LIM HOX gene 2, LIM/homeobox protein Lhx2
Molecular Weight (g/mol)	70.8 kDa
Gene ID (Entrez)	9355
Formulation	50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Gene Symbol	LHX2
Research Category	Neuroscience, Stem Cells
Storage Requirements	Store at -80°C. Avoid freeze-thaw cycles.
For Use With (Application)	Western Blot,ELISA,Protein Array,Immunoaffinity Purification
Protein	LHX2

2,993

Novus Biologicals™ Recombinant Human LIMCH1 GST (N-Term) Protein

Recombinant Protein

Pricing & Availability
Specifications

Purity or Quality Grade	>80% by SDS-PAGE and Coomassie blue staining
Gene Alias	DKFZp434I0312, DKFZp686A01247, DKFZp686B2470, DKFZp686G18243, DKFZp686G2094, DKFZp781C1754, DKFZp781I1455, KIAA1102, LIM and calponin homology domains 1, LIM and calponin homology domains-containing protein 1, LIMCH1A, LMO7B, MGC72127
Molecular Weight (g/mol)	127.8 kDa
Gene ID (Entrez)	22998
Formulation	50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Gene Symbol	LIMCH1
Research Category	Cell Biology
Storage Requirements	Store at -80°C. Avoid freeze-thaw cycles.
For Use With (Application)	Western Blot,ELISA,Protein Array,Immunoaffinity Purification
Protein	LIMCH1

2,994

Novus Biologicals™ Recombinant Human WAPL GST (N-Term) Protein

Recombinant Protein

Pricing & Availability
Specifications

Purity or Quality Grade	>80% by SDS-PAGE and Coomassie blue staining
Gene Alias	FOEKIAA0261friend of EBNA2 (Epstein-Barr virus nuclear protein 2), Friend of EBNA2 protein, WAPLwings apart-like protein homolog, wings apart-like homolog (Drosophila)
Molecular Weight (g/mol)	69.96 kDa
Gene ID (Entrez)	23063
Formulation	50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Gene Symbol	WAPAL
Research Category	DNA Repair
Storage Requirements	Store at -80°C. Avoid freeze-thaw cycles.
For Use With (Application)	Western Blot,ELISA,Protein Array,Immunoaffinity Purification
Protein	WAPL

2,995

Novus Biologicals™ Recombinant Human RNF11 GST (N-Term) Protein

Recombinant Protein

Pricing & Availability
Specifications

Purity or Quality Grade	>80% by SDS-PAGE and Coomassie blue staining
Gene Alias	CGI-123, MGC51169, ring finger protein 11, SID1669, Sid1669p
Molecular Weight (g/mol)	42.68 kDa
Gene ID (Entrez)	26994
Formulation	50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Gene Symbol	RNF11
Research Category	Zinc Finger
Storage Requirements	Store at -80°C. Avoid freeze-thaw cycles.
For Use With (Application)	Western Blot,ELISA,Protein Array,Immunoaffinity Purification
Protein	RNF11

2,996

Invitrogen™ Human PAK4, GST Tag Recombinant Protein

Recombinant Protein

Pricing & Availability

2,997

Invitrogen™ Human RIPK2, His Tag Recombinant Protein

Recombinant Protein

Pricing & Availability
Specifications

Protein Family	Kinases & Inhibitors
Conjugate	Unconjugated
Form	Liquid
pH Range	7.5
Common Name	RIP2
Molecular Weight (g/mol)	38.9 kDa
KinaseFamily	RIPK Kinase Family
Kinase Group	Ser⁄Thr Kinases: TKL Group
Expression System	Insect cells
For Use With (Application)	Kinase Assay
Name	Human RIPK2, His Tag
Purification Method	Purified
Gene Alias	2210420D18Rik; CARD3; CARD-carrying kinase; CARD-containing IL-1 beta ICE-kinase; CARD-containing interleukin-1 beta-converting enzyme (ICE)-associated kinase; CARD-containing interleukin-1 beta-converting enzyme-associated kinase; CARDIAK; CCK; D4Bwg0615e; EC 2.7.11.1; GIG30; growth-in; growth-inhibiting gene 30; kinase RIPK2; receptor (TNFRSF)-interacting serine-threonine kinase 2; receptor interacting serine/threonine kinase 2; receptor-interacting protein (RIP)-like interacting caspase-like apoptosis regulatory protein (CLARP) kinase; receptor-interacting protein 2; receptor-interacting serine/threonine-protein kinase 2; receptor-interacting serine-threonine kinase 2; RICK; RIP 2; RIP2; RIP-2; Ripk2; RIP-like; RIP-like-interacting CLARP kinase; Tyrosine-protein kinase RIPK2; UNQ277/PRO314/PRO34092; WUGSC:H_RG437L15.1
Protein Form	Recombinant, Catalytic
Formulation	50mM tris HCl with 0.5mM EDTA, 50% glycerol, 2mM DTT, 0.02% Triton X-100, 150mM NaCl and no preservative; pH 7.5
Species	Human
Recombinant	Recombinant
Shipping Condition	Dry Ice
Content And Storage	-80°C, Avoid Freeze/Thaw Cycles
Gene Symbol	RIPK2
Sequence	1-299
Storage Requirements	-80°C, Avoid Freeze/Thaw Cycles
Concentration	See Label
Protein Subtype	Serine/Threonine Kinases
Accession Number	O43353
Regulatory Status	RUO
Product Type	Protein
Protein Length	1-299
Gene ID (Entrez)	8767
Protein Tag	His-tag

2,998

Invitrogen™ Human BHMT (aa 349-399) Control Fragment Recombinant Protein

Recombinant Protein

Pricing & Availability

2,999

Invitrogen™ Human SEZ6L2 (aa 428-509) Control Fragment Recombinant Protein

Recombinant Protein

Pricing & Availability

3,000

Novus Biologicals™ EIF1AX Protein

Highly purified. Generating reliable and reproducible results.

Pricing & Availability
Specifications

Regulatory Status	RUO
Purification Method	Protein
Purity or Quality Grade	>90%
Conjugate	Unconjugated
Common Name	EIF1AX
Molecular Weight (g/mol)	18.6kDa
Gene ID (Entrez)	1964
Formulation	Liquid. 20mM Tris-HCl buffer (pH 8.0) containing 40% glycerol, 5mM DTT, 200mM NaCl
Immunogen	MGSSHHHHHHSSGLVPRGSHMPKNKGKGGKNRRRGKNENESEKRELVFKEDGQEYAQVIKMLGNGRLEAMCFDGVKRLCHIRGKLRKKVWINTSDIILVGLRDYQDNKADVILKYNADEARSLKAYGELPEHAKINETDTFGPGDDDEIQFDDIGDDDEDIDDI
Storage Requirements	Store at -80°C. Avoid freeze-thaw cycles.
Concentration	1mg/mL
For Use With (Application)	ELISA,SDS-PAGE
Source	Human

Prev
1
...
198
199
200
201
...
8,507
Next

Recombinant Proteins

Filtered Search Results

Narrow Results

Novus Biologicals™ Recombinant Human MEIS1 GST (N-Term) Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ Recombinant Human MBTPS1 GST (N-Term) Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ Recombinant Human Niemann-Pick C1 GST (N-Term) Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

R&D Systems™ Recombinant SARS-CoV-2 F486V Spike RBD His-tag Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ Recombinant Human OSBPL3 GST (N-Term) Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ Recombinant Human LHX2 GST (N-Term) Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ Recombinant Human LIMCH1 GST (N-Term) Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ Recombinant Human WAPL GST (N-Term) Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ Recombinant Human RNF11 GST (N-Term) Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ EIF1AX Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ Recombinant Human MEIS1 GST (N-Term) Protein

Novus Biologicals™ Recombinant Human MBTPS1 GST (N-Term) Protein

Novus Biologicals™ Recombinant Human Niemann-Pick C1 GST (N-Term) Protein

R&D Systems™ Recombinant SARS-CoV-2 F486V Spike RBD His-tag Protein

Novus Biologicals™ Recombinant Human OSBPL3 GST (N-Term) Protein

Novus Biologicals™ Recombinant Human LHX2 GST (N-Term) Protein

Novus Biologicals™ Recombinant Human LIMCH1 GST (N-Term) Protein

Novus Biologicals™ Recombinant Human WAPL GST (N-Term) Protein

Novus Biologicals™ Recombinant Human RNF11 GST (N-Term) Protein

Novus Biologicals™ EIF1AX Protein