Recombinant Proteins

Modified or manipulated proteins encoded by recombinant DNA and suitable for a variety of purposes including the modification of gene sequences, mass protein production, and the manufacture of commercial products.

3,601 – 3,615 of 115,750 results

3,601

R&D Systems™ Recombinant Human GPR56 Protein

Extensive quality control produces industry leading bioactivity and lot-to-lot consistency that instills confidence in results and ensures reproducibility.

Pricing & Availability

3,602

R&D Systems™ Recombinant Mouse sTNF RII/TNFRSF1B Protein

Extensive quality control produces industry leading bioactivity and lot-to-lot consistency that instills confidence in results and ensures reproducibility. Applications: Bioactivity

Pricing & Availability
Specifications

Purity or Quality Grade	97%, by SDS-PAGE under reducing conditions and visualized by silver stain.
Conjugate	Unconjugated
Molecular Weight (g/mol)	25 kDa
Gene ID (Entrez)	21938
Quantity	50 μg
Storage Requirements	Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70° C as supplied. 1 month, 2 to 8° C under sterile conditions after reconstitution. 3 months, -20 to -70° C under sterile conditions after reconstitution.
Source	E. coli-derived mouse TNF RII/TNFRSF1B protein Val23-Gly258
Recombinant	Recombinant
Name	TNF RII/TNFRSF1B

3,603

R&D Systems™ Recombinant Human S100A13 Protein

Extensive quality control produces industry leading bioactivity and lot-to-lot consistency that instills confidence in results and ensures reproducibility.

Pricing & Availability

3,604

R&D Systems™ Recombinant SARS-CoV-2 F486I Spike RBD His-tag Protein

Pricing & Availability

3,605

Invitrogen™ Human VCAM-1 Fragment Recombinant Protein

Recombinant Protein

Pricing & Availability
Specifications

Regulatory Status	RUO
Purity or Quality Grade	>95%, by SDS-PAGE under reducing conditions
Conjugate	Unconjugated
Form	Liquid
Formulation	PBS with 50% glycerol and no preservative
Sequence	Amino acids Gln109-Lys311 containing an N-terminal His-tag
For Use With (Application)	Control,Western Blot
Source	E. coli
Name	Human VCAM-1 Fragment
Recombinant	Recombinant

3,606

Invitrogen™ Human RBP4 Recombinant Protein

Recombinant Protein

Pricing & Availability
Specifications

Regulatory Status	RUO
Purity or Quality Grade	>95%, by SDS-PAGE under reducing conditions
Conjugate	Unconjugated
Form	Liquid
Molecular Weight (g/mol)	25.57 kDa
Formulation	Laemmli with no preservative; pH 6.8
Sequence	Amino acids Glu19-Leu201 containing an N-terminal His-tag
Concentration	0.05 mg/mL
For Use With (Application)	Control,Western Blot
Source	E. coli
Name	Human RBP4
Recombinant	Recombinant

3,607

R&D Systems™ Recombinant Human ADAM23 Protein

Extensive quality control produces industry leading bioactivity and lot-to-lot consistency that instills confidence in results and ensures reproducibility.

Pricing & Availability

3,608

Novus Biologicals™ Recombinant Human ZADH2 His Protein

Highly purified. Generating reliable and reproducible results.

Pricing & Availability
Specifications

Purity or Quality Grade	>90%, by SDS-PAGE under reducing conditions and visualized by Colloidal Coomassie™ Blue stain
Conjugate	Unconjugated
Gene Alias	MGC45594, zinc binding alcohol dehydrogenase domain containing 2, zinc-binding alcohol dehydrogenase domain-containing protein 2
Common Name	ZADH2
Molecular Weight (g/mol)	TMW: 39kDa
Gene ID (Entrez)	284273
Formulation	Phosphate buffered saline (pH 7.4) containing 20% glycerol
Storage Requirements	Store at 4°C short term. Aliquot and store at −20°C long term. Avoid freeze-thaw cycles.
Concentration	0.25mg/mL
For Use With (Application)	SDS-PAGE
Recombinant	Recombinant

3,609

Novus Biologicals™ Firefly Luciferase Recombinant Protein

Highly purified and high bioactivity. Generating reliable and reproducible results. Applications: Functional, SDS-Page, Bioactivity

Pricing & Availability
Specifications

Regulatory Status	RUO
Purity or Quality Grade	>95% by PAGE
Conjugate	Unconjugated
Gene Alias	ec 1.13.12.7, Fluc
Product Type	Recombinant Protein
Molecular Weight (g/mol)	38.5 kDa
Formulation	20mM Tris-HCl (pH8.0) containing 1mM DTT, 10% glycerol
Storage Requirements	Store at 4°C short term. Aliquot and store at −20°C long term. Avoid freeze-thaw cycles.
Cross Reactivity	Firefly
For Use With (Application)	Bioactivity
Source	E.coli
Recombinant	Recombinant
Name	Firefly Luciferase Recombinant Protein

3,610

Novus Biologicals™ Recombinant Human FBXO2 His Protein

Highly purified. Generating reliable and reproducible results.

Pricing & Availability
Specifications

Purity or Quality Grade	>80%, by SDS-PAGE under reducing conditions and visualized by Colloidal Coomassie™ Blue stain
Conjugate	Unconjugated
Gene Alias	FBG1, F-box gene 1, F-box only protein 2, F-box protein 2, Fbs1, FBX2Fbg1, Nfb42, OCP1, organ of Corti protein 1
Common Name	FBXO2
Molecular Weight (g/mol)	TMW: 35.7kDa
Gene ID (Entrez)	26232
Formulation	20mM Tris-HCl buffer (pH 8.0) containing 0.15M NaCl, 30% glycerol, 1mM DTT
Storage Requirements	Store at 4°C short term. Aliquot and store at −20°C long term. Avoid freeze-thaw cycles.
Concentration	0.25mg/mL
For Use With (Application)	SDS-PAGE
Recombinant	Recombinant

3,611

Novus Biologicals™ Recombinant Human SYF2 His Protein

Highly purified. Generating reliable and reproducible results.

Pricing & Availability

3,612

Novus Biologicals™ Recombinant Mouse GITR Ligand/TNFSF18 Protein

Highly purified. Generating reliable and reproducible results. Applications: Functional, In vitro assay, SDS-Page

Pricing & Availability

3,613

Novus Biologicals™ RABIF/MSS4 Protein

Highly purified. Generating reliable and reproducible results.

Pricing & Availability
Specifications

Regulatory Status	RUO
Purification Method	Protein
Purity or Quality Grade	>85%
Conjugate	Unconjugated
Common Name	RABIF/MSS4
Molecular Weight (g/mol)	16.0kDa
Formulation	Liquid. 20mM Tris-HCl buffer (pH 8.0) containing 20% glycerol 0.1M NaCl, 1mM DTT.
Immunogen	RABIF, 1-123 aa. MGSSHHHHHHSSGLVPRGSHMEPAEQPSELVSAEGRNRKAVLCQRCGSRVLQPGTALFSRRQLFLPSMRKKPALSDGSNPDGDLLQEHWLVEDMFIFENVGFTKDVGNIKFLVCADCEIGPIGWHCLDDKNSFYVALERVSHE
Storage Requirements	Store at -80°C. Avoid freeze-thaw cycles.
Concentration	0.5mg/mL
For Use With (Application)	ELISA,SDS-PAGE
Source	Human

3,614

R&D Systems™ Recombinant Human TACE/ADAM17 Cytosolic Western Blot Std

Extensive quality control produces lot-to-lot consistency that instills confidence in results and ensures reproducibility.

Pricing & Availability

3,615

R&D Systems™ Recombinant Mouse TIMP-1 Western Blot Standard Protein

Extensive quality control produces lot-to-lot consistency that instills confidence in results and ensures reproducibility.

Pricing & Availability

Prev
1
...
239
240
241
242
...
7,717
Next

Welcome to fishersci.com

Recombinant Proteins

Filtered Search Results

Narrow Results

Novus Biologicals™ Recombinant Human ZADH2 His Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ Firefly Luciferase Recombinant Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ Recombinant Human FBXO2 His Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ Recombinant Human SYF2 His Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ Recombinant Mouse GITR Ligand/TNFSF18 Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ RABIF/MSS4 Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ Recombinant Human ZADH2 His Protein

Novus Biologicals™ Firefly Luciferase Recombinant Protein

Novus Biologicals™ Recombinant Human FBXO2 His Protein

Novus Biologicals™ Recombinant Human SYF2 His Protein

Novus Biologicals™ Recombinant Mouse GITR Ligand/TNFSF18 Protein

Novus Biologicals™ RABIF/MSS4 Protein