Recombinant Proteins
Modified or manipulated proteins encoded by recombinant DNA and suitable for a variety of purposes including the modification of gene sequences, mass protein production, and the manufacture of commercial products.
For Use With (Application)
- (2)
- (2,391)
- (1)
- (23,537)
- (5)
- (1)
- (1)
- (68)
- (547)
- (9,349)
- (23)
- (1)
- (7)
- (2)
- (13)
- (3)
- (4)
- (3)
- (1)
- (2)
- (4)
- (14)
- (70)
- (2)
- (2)
- (2)
- (1)
- (3)
- (2)
- (1)
- (157)
- (3)
- (4)
- (1)
- (1)
- (1)
- (3)
- (253)
- (26,478)
- (1)
- (1)
- (2)
- (1)
- (25)
- (36,443)
- (1,335)
- (2)
- (2)
- (32)
- (3)
- (787)
- (14)
- (2)
- (1)
- (8)
- (1)
- (5)
- (1)
- (123)
- (1)
- (144)
- (1,405)
- (3)
- (4)
- (7)
- (5)
- (1)
- (3)
- (1)
- (1)
- (1)
- (14)
- (11,447)
- (48)
- (6)
- (31)
- (16)
- (1)
- (10)
- (4)
- (110)
- (18)
- (2)
- (3)
- (119)
- (4)
- (148)
- (98)
- (19)
- (1)
- (1)
- (4)
- (1)
- (1,578)
- (2)
- (1)
- (160)
- (48)
- (11)
- (3)
- (1)
- (2)
- (9)
- (27)
- (2)
- (21,952)
- (2,939)
- (4)
- (1)
- (2)
- (114)
- (2,860)
- (4)
- (1)
- (1)
- (4)
- (1)
- (1)
- (3)
- (1)
- (34,931)
- (6)
- (3)
- (1)
- (1)
- (63)
- (6)
- (2)
- (7)
- (5)
- (1)
- (2)
- (6)
- (1)
- (1)
- (8,296)
- (6)
- (4)
- (4)
- (1)
- (3)
- (1)
- (3)
- (2)
- (14)
- (19)
- (1)
- (3)
- (3)
- (4)
- (36,975)
- (1,823)
- (1)
- (3)
Recombinant
- (285)
- (9)
- (66,416)
- (1)
Form
- (15)
- (1)
- (2)
- (45,198)
- (10,339)
- (245)
- (168)
- (56)
- (3,358)
Species
- (2)
- (1)
- (2)
- (1)
- (90)
- (557)
- (96)
- (2)
- (1)
- (1)
- (2)
- (1)
- (27)
- (5)
- (8)
- (15)
- (1)
- (72)
- (1)
- (1,302)
- (1)
- (3)
- (16)
- (1)
- (3)
- (1)
- (1)
- (1)
- (8)
- (1)
- (4)
- (1)
- (1)
- (29,100)
- (5)
- (22)
- (8)
- (4)
- (1,290)
- (2)
- (1)
- (1)
- (3)
- (1)
- (1)
- (8)
- (14)
- (32)
- (24)
- (1)
- (2)
- (16)
- (233)
- (9)
- (2)
- (5)
- (1)
- (2)
- (2)
- (2)
- (23)
- (5)
- (3)
- (3)
- (2)
- (14)
- (23,572)
- (1)
- (44)
Regulatory Status
- (79)
- (54,649)
Filtered Search Results
Products from some of our suppliers do not display in filtered search results. Please
clear all filters
to see these products.
Search Within Results
Keyword Search:
Clear All
6,181
–
6,195
of
129,857
results
R&D Systems™ Recombinant Mouse GFR alpha-1 His-tag Protein
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
The Recombinant Mouse GFR alpha-1 His-tag Protein is derived from NS0
Novus Biologicals™ Recombinant Human ICEBERG His Protein
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Highly purified. Generating reliable and reproducible results.
Novus Biologicals™ DHRS1 Recombinant Protein Antigen
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Recombinant Protein
| Content And Storage | -20°C, Avoid Freeze/Thaw Cycles |
|---|---|
| Purity or Quality Grade | >95% as determined by SDS-PAGE. |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Common Name | LAIR1 (CD305) |
| Molecular Weight (g/mol) | 42.8 kDa |
| Gene Symbol | LAIR1 |
| Endotoxin Concentration | <1.0 EU/μg |
| Sequence | Human LAIR1, amino acids Met1-Tyr165 (Accession # Q6GTX8.1) with a C-terminal human IgG1 Fc region |
| Expression System | HEK293 cells |
| For Use With (Application) | Control,Neutralization |
| Name | Human LAIR1 Fc Chimera |
| Accession Number | Q6GTX8 |
| Purification Method | Purified |
| Gene Alias | 5133400O11Rik; BB115266; CD305; D7Bwg0421e; immunoglobulin heavy chain variable region; Lair1; Lair-1; leukocyte associated immunoglobulin like receptor 1; leukocyte-associated Ig-like receptor 1; leukocyte-associated Ig-like receptor-1; leukocyte-associated immunoglobulin-like receptor 1; rLAIR1 |
| Format | Lyophilized |
| Product Type | Protein |
| Gene ID (Entrez) | 3903 |
| Formulation | PBS with 5% mannitol, 5% trehalose, 0.01% Tween 80 and no preservative; pH 7.4 |
| Protein Tag | Fc-tag |
| Recombinant | Recombinant |
Novus Biologicals™ Recombinant Human DEFB116 His Protein
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Highly purified. Generating reliable and reproducible results. Applications: SDS-Page
R&D Systems™ Recombinant Human Otolin-1 His-tag Protein
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Measured by its binding ability in a functional ELISA.
R&D Systems™ Recombinant Human HAI-2A Protein
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Extensive quality control produces lot-to-lot consistency that instills confidence in results and ensures reproducibility. Applications: Inhibition Activity
Novus Biologicals™ ARL14 Protein
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Highly purified. Generating reliable and reproducible results.
Novus Biologicals™ Clathrin light chain Protein
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Highly purified. Generating reliable and reproducible results.
| Regulatory Status | RUO |
|---|---|
| Purification Method | SDS-PAGE |
| Purity or Quality Grade | >90% |
| Conjugate | Unconjugated |
| Common Name | Clathrin light chain |
| Storage Requirements | Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| For Use With (Application) | SDS-PAGE |
| Source | Human |
Promotions Available
Spectrum™ Chemical Albumin, Bovine, Fraction V, Lyophilized Powder
Spectrum™ Chemical Albumin, Bovine, Fraction V, Lyophilized Powder
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
AL135, 9048-46-8
| Form | Lyophilized |
|---|
Gibco™ Human Sox2-TAT Recombinant Protein, PeproTech®
Recombinant Protein
Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
| Content And Storage | -20°C |
|---|---|
| Purity or Quality Grade | ≥ 95% by SDS-PAGE gel and HPLC analyses. |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Common Name | SOX2-TAT |
| Molecular Weight (g/mol) | 36 kDa |
| Gene Symbol | SOX2 |
| Endotoxin Concentration | <1 EU/μg |
| Sequence | MYNMMETELK PPGPQQTSGG GGGNSTAAAA GGNQKNSPDR VKRPMNAFMV WSRGQRRKMA QENPKMHNSE ISKRLGAEWK LLSETEKRPF IDEAKRLRAL HMKEHPDYKY RPRRKTKTLM KKDKYTLPGG LLAPGGNSMA SGVGVGAGLG AGVNQRMDSY AHMNGWSNGS YSMMQDQLGY PQHPGLNAHG AAQMQPMHRY DVSALQYNSM TSSQTYMNGS PTYSMSYSQQ GTPGMALGSM GSVVKSEASS SPPVVTSSSH SRAPCQAGDL RDMISMYLPG AEVPEPAAPS RLHMSQHYQS GPVPGTAING TLPLSHMGGY GRKKRRQRRR |
| Expression System | E. coli |
| For Use With (Application) | Control |
| Source | E. coli |
| Name | Human Sox2-TAT |
| Accession Number | P48431 |
| Gene Alias | SOX2 |
| Gene ID (Entrez) | 6657 |
| Formulation | Protein with no preservative |
| Protein Tag | TAT-fusion |
| Recombinant | Recombinant |
Novus Biologicals™ PHPT1 Protein
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Highly purified. Generating reliable and reproducible results.
| Regulatory Status | RUO |
|---|---|
| Purification Method | Protein |
| Purity or Quality Grade | >95% |
| Conjugate | Unconjugated |
| Common Name | PHPT1 |
| Molecular Weight (g/mol) | 15.9kDa |
| Gene ID (Entrez) | 29085 |
| Formulation | 20mM Tris-HCl buffer (pH 8.0) containing 0.2M NaCl, 2mM DTT, 10% glycerol |
| Immunogen | PHPT1, 1-125 aa. MGSSHHHHHHSSGLVPRGSHMAVADLALIPDVDIDSDGVFKYVLIRVHSAPRSGAPAAESKEIVRGYKWAEYHADIYDKVSGDMQKQGCDCECLGGGRISHQSQDKKIHVYGYSMAYGPAQHAISTEKIKAKYPDYEVTWANDGY |
| Storage Requirements | Store at -80°C. Avoid freeze-thaw cycles. |
| Concentration | 0.5mg/mL |
| For Use With (Application) | ELISA,SDS-PAGE |
| Source | Human |
Novus Biologicals™ Recombinant Human SIAH2 GST (N-Term) Protein
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Recombinant Protein
| Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
|---|---|
| Gene Alias | E3 ubiquitin-protein ligase SIAH2, EC 6.3.2, EC 6.3.2.-, hSiah2, seven in absentia (Drosophila) homolog 2, Seven in absentia homolog 2, seven in absentia homolog 2 (Drosophila), siah-2 |
| Molecular Weight (g/mol) | 36.63 kDa |
| Gene ID (Entrez) | 6478 |
| Formulation | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer. |
| Gene Symbol | SIAH2 |
| Research Category | Apoptosis, Cancer, Cell Cycle and Replication |
| Storage Requirements | Store at -80°C. Avoid freeze-thaw cycles. |
| For Use With (Application) | Western Blot,ELISA,Protein Array,Immunoaffinity Purification |
| Protein | SIAH2 |
Novus Biologicals™ Recombinant Human CMTM1 GST (N-Term) Protein
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Recombinant Protein
| Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
|---|---|
| Gene Alias | chemokine-like factor super family 1, chemokine-like factor superfamily 1, Chemokine-like factor superfamily member 1, chemokine-like factor-like protein CKLFH1, CKLFH, CKLFH1, CKLFH1a, CKLF-like MARVEL transmembrane domain containing 1, CKLF-like MARVEL transmembrane domain-containing protein 1, CKLFSF1, MGC71870 |
| Molecular Weight (g/mol) | MolecularWeight-theroretical: 39 kDa |
| Gene ID (Entrez) | 113540 |
| Formulation | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer. |
| Gene Symbol | CMTM1 |
| Research Category | Cytokine Research |
| Storage Requirements | Store at -80°C. Avoid freeze/thaw cycles. |
| For Use With (Application) | Western Blot,ELISA,Protein Array,Immunoaffinity Purification |
| Protein | CMTM1 |