Recombinant Proteins

Modified or manipulated proteins encoded by recombinant DNA and suitable for a variety of purposes including the modification of gene sequences, mass protein production, and the manufacture of commercial products.

Search Within Results

7,156 – 7,170 of 119,629 results

7,156

Novus Biologicals™ ACYP1 Protein

Highly purified. Generating reliable and reproducible results.

Pricing & Availability
Specifications

Regulatory Status	RUO
Purification Method	SDS-PAGE
Purity or Quality Grade	>90%
Conjugate	Unconjugated
Common Name	ACYP1
Molecular Weight (g/mol)	13.6kDa
Formulation	Liquid. 20mM Tris-HCl buffer (pH 8.0) containing 20% glycerol, 0.1M NaCl, 1mM DTT
Storage Requirements	Store at -80°C. Avoid freeze-thaw cycles.
Concentration	1.0mg/mL
For Use With (Application)	SDS-PAGE

7,157

Novus Biologicals™ AASD-PPT Protein

Highly purified. Generating reliable and reproducible results.

Pricing & Availability
Specifications

Regulatory Status	RUO
Purification Method	Protein
Purity or Quality Grade	>95%
Conjugate	Unconjugated
Common Name	AASD-PPT
Molecular Weight (g/mol)	36.4kDa
Gene ID (Entrez)	60496
Formulation	Liquid. In 20mM Tris-HCl Buffer (pH 8.0) containing 1mM DTT, 10% Glycerol
Immunogen	AASDHPPT, 14-309aa. Sequence: MGSSHHHHHHSSGLVPRGSHMEGVRWAFSCGTWLPSRAEWLLAVRSIQPEEKERIGQFVFARDAKAAMAGRLMIRKLVAEKLNIPWNHIRLQRTAKGKPVLAKDSSNPYPNFNFNISHQGDYAVLAAEPELQVGIDIMKTSFPGRGSIPEFFHIMKRKFTNKEWETIRSFKDEWTQLDMFYRNWALKESFIKAIGVGLGFELQRLEFDLSPLNLDIGQVYKETRLFLDGEEEKEWAFEESKIDEHHFVAVALRKPDGSRHQDVPSQDDSKPTQRQFTILNFNDLMSSAVPMTPEDPSFWDCFCFTEEIPIRNGTKS
Storage Requirements	Store at -80°C. Avoid freeze-thaw cycles.
Concentration	1mg/mL
For Use With (Application)	ELISA,SDS-PAGE
Source	Human

7,158

R&D Systems™ Recombinant Human Agrin Protein, N-terminal

Extensive quality control produces industry leading bioactivity and lot-to-lot consistency that instills confidence in results and ensures reproducibility.

Pricing & Availability

7,159

Novus Biologicals™ Recombinant Human V-type proton ATPase subunit F His Protein

Highly purified. Generating reliable and reproducible results.

Pricing & Availability
Specifications

Purity or Quality Grade	>90%, by SDS-PAGE under reducing conditions and visualized by Colloidal Coomassie™ Blue stain
Conjugate	Unconjugated
Gene Alias	ATP6S14adenosinetriphosphatase 14k chain, ATPase, H+ transporting, lysosomal 14kDa, V1 subunit F, H(+)-transporting two-sector ATPase, 14kD subunit, MGC117321, MGC126037, MGC126038, vacuolar ATP synthase subunit F, vacuolar proton pump F subunit, Vacuolar proton pump subunit F, VATFATPase, vacuolar, 14 kD, V-ATPase 14 kDa subunit, V-ATPase F subunit, V-ATPase subunit F, Vma7, V-type proton ATPase subunit F
Common Name	V-type proton ATPase subunit F
Molecular Weight (g/mol)	TMW: 15.8kDa
Gene ID (Entrez)	9296
Formulation	Phosphate buffered saline (pH7.4) containing, 50% glycerol, 1mM DTT
Storage Requirements	Store at 4°C short term. Aliquot and store at −20°C long term. Avoid freeze-thaw cycles.
Concentration	0.5mg/mL
For Use With (Application)	SDS-PAGE
Recombinant	Recombinant

7,160

BD Recombinant Rat IFN-γ

Potent multifunctional cytokine, secreted by activated NK cells and CD4+TCRαβ+, CD8+TCRαβ+, and TCRγδ+T cells

Pricing & Availability

7,161

Invitrogen™ Human EGF Recombinant Protein

Recombinant Protein

Pricing & Availability
Specifications

Regulatory Status	RUO
Conjugate	Unconjugated
Form	Lyophilized
Molecular Weight (g/mol)	6.2 kDa
Formulation	protein with no preservative
Sequence	Human EGF recombinant protein contains 53 amino acids
Concentration	0.1 mg/mL
For Use With (Application)	Control
Source	E. coli
Name	Human EGF
Recombinant	Recombinant

7,162

Novus Biologicals™ TMPRSS11A Recombinant Protein Antigen

Recombinant Protein

Pricing & Availability

7,163

Novus Biologicals™ YF5 Recombinant Protein Antigen

Recombinant Protein

Pricing & Availability

7,164

Novus Biologicals™ Recombinant Human MPPED2 His Protein

Highly purified. Generating reliable and reproducible results.

Pricing & Availability

7,165

R&D Systems™ Recombinant Human ACE-2 His-tag Biotinylated Protein

Biotinylated via Amines

Pricing & Availability

7,166

Novus Biologicals™ Recombinant Human Endothelin-3 His Protein

Highly purified. Generating reliable and reproducible results.

Pricing & Availability
Specifications

Purity or Quality Grade	>85%, by SDS-PAGE
Conjugate	Unconjugated
Gene Alias	endothelin 3, endothelin-3, ET3, ET-3, HSCR4, MGC15067, MGC61498, PPET3, preproendothelin-3, truncated endothelin 3, WS4B
Common Name	Endothelin-3
Molecular Weight (g/mol)	TMW: 25.2kDa
Gene ID (Entrez)	1908
Formulation	Phosphate buffered saline (pH7.4), 10% glycerol
Storage Requirements	Store at 4°C short term. Aliquot and store at −20°C long term. Avoid freeze-thaw cycles.
Concentration	0.25mg/mL
For Use With (Application)	SDS-PAGE
Recombinant	Recombinant

7,167

Novus Biologicals™ Annexin A11 Protein

Highly purified. Generating reliable and reproducible results.

Pricing & Availability
Specifications

Purity or Quality Grade	>95%
Conjugate	Unconjugated
Common Name	Annexin A11
Molecular Weight (g/mol)	56.6 kDa
Quantity	250 μg
Storage Requirements	Store at -80°C. Avoid freeze-thaw cycles.
Concentration	0.25 mg/mL
For Use With (Application)	SDS-PAGE
Source	E. coli
Regulatory Status	RUO
Purification Method	SDS-PAGE
Formulation	PBS containing 20% glycerol, 2 mM DTT, 100 mM NaCl
Immunogen	ANXA11, 1-505 aa, Human, His tag, E. coli
Recombinant	Recombinant

7,168

R&D Systems™ Recombinant Cynomolgus LIFR alpha Fc Chimera Protein

Carrier Free Recombinant Protein

Pricing & Availability

7,169

Novus Biologicals™ Recombinant Human PCMTD1 His Protein

Highly purified. Generating reliable and reproducible results.

Pricing & Availability

7,170

R&D Systems™ Recombinant SARS-CoV-2 B.1.617.2 Spike RBD Fc Protein

Delta Variant (India)

Pricing & Availability

Prev
1
...
476
477
478
479
...
7,976
Next

Recombinant Proteins

Filtered Search Results

Narrow Results

Novus Biologicals™ ACYP1 Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ AASD-PPT Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ Recombinant Human V-type proton ATPase subunit F His Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ TMPRSS11A Recombinant Protein Antigen Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ YF5 Recombinant Protein Antigen Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ Recombinant Human MPPED2 His Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ Recombinant Human Endothelin-3 His Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ Annexin A11 Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ Recombinant Human PCMTD1 His Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ ACYP1 Protein

Novus Biologicals™ AASD-PPT Protein

Novus Biologicals™ Recombinant Human V-type proton ATPase subunit F His Protein

Novus Biologicals™ TMPRSS11A Recombinant Protein Antigen

Novus Biologicals™ YF5 Recombinant Protein Antigen

Novus Biologicals™ Recombinant Human MPPED2 His Protein

Novus Biologicals™ Recombinant Human Endothelin-3 His Protein

Novus Biologicals™ Annexin A11 Protein

Novus Biologicals™ Recombinant Human PCMTD1 His Protein