Recombinant Proteins

Modified or manipulated proteins encoded by recombinant DNA and suitable for a variety of purposes including the modification of gene sequences, mass protein production, and the manufacture of commercial products.

Search Within Results

8,236 – 8,250 of 119,730 results

8,236

Invitrogen™ Human VEGFR1 Recombinant Protein

Recombinant Protein

Pricing & Availability
Specifications

Regulatory Status	RUO
Purity or Quality Grade	>95%, by SDS-PAGE under reducing conditions
Conjugate	Unconjugated
Form	Liquid
Formulation	25 mM sodium acetate with 50% glycerol and no preservative; pH 4.8
Sequence	Amino acids Asp31-Ile328 containing an N-terminal His-tag
Concentration	0.29 mg/mL
For Use With (Application)	Control,Western Blot
Source	E. coli
Name	Human VEGFR1
Recombinant	Recombinant

8,237

Novus Biologicals™ Recombinant E. coli MBP His Protein

Highly purified. Generating reliable and reproducible results.

Pricing & Availability

8,238

Novus Biologicals™ Recombinant Human FARSB His Protein

Highly purified. Generating reliable and reproducible results. Applications: SDS-Page

Pricing & Availability
Specifications

Purity or Quality Grade	>85%, by SDS-PAGE
Conjugate	Unconjugated
Gene Alias	EC 6.1.1, EC 6.1.1.20, FARSLBphenylalanine-tRNA ligase beta chain, FRSBphenylalanine tRNA ligase 1, beta, cytoplasmic, PheHB, Phenylalanine--tRNA ligase beta chain, phenylalanine-tRNA synthetase-like, beta subunit, phenylalanyl-tRNA synthetase beta chain, phenylalanyl-tRNA synthetase beta-subunit, phenylalanyl-tRNA synthetase, beta subunit, phenylalanyl-tRNA synthetase-like, beta subunit, PheRS
Common Name	FARSB
Molecular Weight (g/mol)	TMW: 68.5kDa
Gene ID (Entrez)	10056
Formulation	20mM Tris-HCl buffer (pH 8.0) containing 10% glycerol
Storage Requirements	Store at 4°C short term. Aliquot and store at −20°C long term. Avoid freeze-thaw cycles.
Concentration	1mg/mL
For Use With (Application)	SDS-PAGE
Recombinant	Recombinant

8,239

Novus Biologicals™ TRPM1 Recombinant Protein Antigen

Recombinant Protein

Pricing & Availability

8,240

Novus Biologicals™ HIF-1 alpha Protein

Highly purified. Generating reliable and reproducible results.

Pricing & Availability
Specifications

Regulatory Status	RUO
Purification Method	Protein
Purity or Quality Grade	>80%
Conjugate	Unconjugated
Common Name	HIF-1 alpha
Molecular Weight (g/mol)	11.8kDa
Gene ID (Entrez)	3091
Formulation	Liquid. In 20mM Tris buffer (pH 8.0) containing 20% glycerol, 1mM DTT, 0.2M NaCl, 1mM EDTA.
Immunogen	HIF1a, 1-85 aa MGSSHHHHHHSSGLVPRGSHMEGAGGANDKKKISSERRKEKSRDAARSRRSKESEVFYELAHQLPLPHNVSSHLDKASVMRLTISYLRVRKLLDAGDLDIEDDMK
Storage Requirements	Store at -80°C. Avoid freeze-thaw cycles.
Concentration	0.25mg/mL
For Use With (Application)	ELISA,SDS-PAGE
Source	Human

8,241

Novus Biologicals™ Recombinant Human Integrin beta 1/CD29 Protein

Highly purified. Generating reliable and reproducible results. Applications: SDS-Page

Pricing & Availability
Specifications

Conjugate	Unconjugated
Molecular Weight (g/mol)	79.4 kDa
Gene Symbol	ITGB1
Endotoxin Concentration	<1.0 EU per 1μg of protein (determined by LAL method)
Storage Requirements	Store at 4°C short term. Aliquot and store at −20°C long term. Avoid freeze-thaw cycles.
Concentration	1mg/mL
For Use With (Application)	SDS-PAGE
Source	Baculovirus
Name	Recombinant Human Integrin beta 1/CD29 Protein
Regulatory Status	RUO
Purification Method	>90%, by SDS-PAGE
Gene Alias	CD29, CD29 antigen, Fibronectin receptor subunit beta, FNRBVLAB, GPIIA, integrin beta-1, integrin VLA-4 beta subunit, integrin, beta 1 (fibronectin receptor, beta polypeptide, antigen CD29 includesMDF2, MSK12), MDF2, MSK12, very late activation protein, b
Product Type	Recombinant Protein
Gene ID (Entrez)	3688
Formulation	Liquid. PBS (pH 7.4) containing 10% glycerol
Cross Reactivity	Human
Recombinant	Recombinant

8,242

Novus Biologicals™ Recombinant Human PSMB7 His Protein

Highly purified. Generating reliable and reproducible results.

Pricing & Availability

8,243

Novus Biologicals™ HIV-1 p24 Protein

Highly purified. Generating reliable and reproducible results.

Pricing & Availability
Specifications

Purity or Quality Grade	>80%
Conjugate	Unconjugated
Common Name	HIV-1 p24
Molecular Weight (g/mol)	21.2kDa
Storage Requirements	Store at -80°C. Avoid freeze-thaw cycles.
Concentration	0.5mg/mL
For Use With (Application)	ELISA,SDS-PAGE
Source	Recombinant HIV1-p24 protein, fused to His-tag at N-terminus, expressed in E. coli
Accession Number	AAA44987
Regulatory Status	RUO
Purification Method	Protein
Formulation	20mM Tris-HCl Buffer (pH 8.0) containing 100mM NaCl, 0.1mM PMSF, 10% Glycerol
Immunogen	HIV1-p24, 155-321aa, HIV-1, His tag, E. coli (AAA44987).
Recombinant	Recombinant

8,244

Novus Biologicals™ PEX11B Recombinant Protein Antigen

Recombinant Protein

Pricing & Availability

8,245

Novus Biologicals™ PNPLA6 Recombinant Protein Antigen

Recombinant Protein

Pricing & Availability

8,246

Novus Biologicals™ Recombinant Human PTMS His Protein

Highly purified. Generating reliable and reproducible results.

Pricing & Availability

8,247

Novus Biologicals™ CIITA Recombinant Protein Antigen

Recombinant Protein

Pricing & Availability

8,248

Novus Biologicals™ Recombinant Human UFD1L His Protein

Highly purified. Generating reliable and reproducible results.

Pricing & Availability

8,249

Novus Biologicals™ Laminin Recombinant Protein Antigen

Recombinant Protein

Pricing & Availability

8,250

Novus Biologicals™ Recombinant Human MKK6/MEK6 His Protein

Recombinant Protein

Pricing & Availability
Specifications

Purity or Quality Grade	>90%, by SDS-PAGE
Gene Alias	MAP kinase kinase 6, MAPK/ERK kinase 6, MAPKK6dual specificity mitogen-activated protein kinase kinase 6, MEK6MAPKK 6, mitogen-activated protein kinase kinase 6, MKK6MEK 6, PRKMK6protein kinase, mitogen-activated, kinase 6 (MAP kinase kinase 6), SAPKK3EC 2.7.12.2
Molecular Weight (g/mol)	M.W. Theoretical: 38.3 kDa
Gene ID (Entrez)	5608
Formulation	PBS (pH 7.4), 20% glycerol
Gene Symbol	MAP2K6
Research Category	Angiogenesis, Apoptosis, Cancer, Cell Cycle and Replication, Hypoxia, Protein Kinase
Endotoxin Concentration	<1 EU per 1ug of protein (determined by LAL method)
Storage Requirements	Store at 4C short term. Aliquot and Store at -20°C long term. Avoid freeze-thaw cycles.
Concentration	1 mg/ml
For Use With (Application)	SDS-PAGE
Protein	MKK6/MEK6

Prev
1
...
548
549
550
551
...
7,982
Next

Recombinant Proteins

Filtered Search Results

Narrow Results

Novus Biologicals™ Recombinant E. coli MBP His Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ Recombinant Human FARSB His Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ TRPM1 Recombinant Protein Antigen Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ HIF-1 alpha Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ Recombinant Human Integrin beta 1/CD29 Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ Recombinant Human PSMB7 His Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ HIV-1 p24 Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ PEX11B Recombinant Protein Antigen Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ PNPLA6 Recombinant Protein Antigen Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ Recombinant Human PTMS His Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ CIITA Recombinant Protein Antigen Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ Recombinant Human UFD1L His Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ Laminin Recombinant Protein Antigen Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ Recombinant Human MKK6/MEK6 His Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ Recombinant E. coli MBP His Protein

Novus Biologicals™ Recombinant Human FARSB His Protein

Novus Biologicals™ TRPM1 Recombinant Protein Antigen

Novus Biologicals™ HIF-1 alpha Protein

Novus Biologicals™ Recombinant Human Integrin beta 1/CD29 Protein

Novus Biologicals™ Recombinant Human PSMB7 His Protein

Novus Biologicals™ HIV-1 p24 Protein

Novus Biologicals™ PEX11B Recombinant Protein Antigen

Novus Biologicals™ PNPLA6 Recombinant Protein Antigen

Novus Biologicals™ Recombinant Human PTMS His Protein

Novus Biologicals™ CIITA Recombinant Protein Antigen

Novus Biologicals™ Recombinant Human UFD1L His Protein

Novus Biologicals™ Laminin Recombinant Protein Antigen

Novus Biologicals™ Recombinant Human MKK6/MEK6 His Protein