Trays
- (1)
- (3)
- (2)
- (14)
- (6)
- (4)
- (1)
- (24)
- (1)
- (8)
- (9)
- (5)
- (12)
- (9)
- (62)
- (7)
- (15)
- (1)
- (2)
- (1)
- (10)
- (2)
- (11)
- (3)
- (7)
- (7)
- (4)
- (2)
- (1)
- (11)
- (1)
- (38)
- (4)
- (3)
- (3)
- (9)
- (1)
- (5)
- (4)
- (3)
- (1)
- (1)
- (1)
- (1)
- (1)
- (2)
- (7)
- (4)
- (19)
- (6)
- (9)
- (1)
- (1)
- (1)
- (2)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (2)
- (2)
- (1)
- (2)
- (1)
- (3)
- (1)
- (2)
- (2)
- (2)
- (1)
- (1)
- (2)
- (13)
- (1)
- (1)
- (1)
- (2)
- (2)
- (3)
- (1)
- (2)
- (2)
- (1)
- (2)
- (1)
- (1)
- (2)
- (2)
- (1)
- (1)
- (1)
- (4)
- (1)
- (1)
- (2)
- (2)
- (1)
- (1)
- (2)
- (1)
- (1)
- (2)
- (2)
- (2)
- (1)
- (1)
- (10)
- (1)
- (1)
- (1)
- (4)
- (1)
- (1)
- (1)
- (2)
- (3)
- (1)
- (2)
- (1)
- (3)
- (1)
- (4)
- (2)
- (1)
- (1)
- (2)
- (1)
- (2)
- (3)
- (2)
- (1)
- (1)
- (1)
- (1)
- (1)
- (2)
- (1)
- (2)
- (1)
- (1)
- (1)
- (1)
- (1)
- (2)
- (1)
- (2)
- (1)
- (1)
- (2)
- (1)
- (4)
- (1)
- (2)
- (1)
- (2)
- (1)
- (3)
- (1)
- (3)
- (2)
- (1)
- (1)
- (2)
- (2)
- (3)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (2)
- (4)
- (1)
- (2)
- (1)
- (2)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (3)
- (5)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (2)
- (1)
- (1)
- (1)
- (1)
- (1)
- (2)
- (2)
- (2)
- (1)
- (1)
- (1)
- (2)
- (1)
- (1)
- (2)
- (1)
- (1)
- (4)
- (2)
- (1)
- (7)
- (3)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (2)
- (5)
- (1)
- (1)
- (1)
- (1)
- (7)
- (1)
- (2)
- (2)
- (3)
- (1)
- (1)
- (2)
- (5)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (2)
- (9)
- (7)
- (4)
- (1)
- (1)
- (1)
- (2)
- (1)
- (2)
- (1)
- (2)
- (8)
- (4)
- (4)
- (2)
- (1)
- (1)
- (1)
- (1)
- (2)
- (1)
- (2)
- (2)
- (7)
- (2)
- (1)
- (1)
- (2)
- (4)
- (6)
- (1)
- (1)
- (4)
- (2)
- (1)
- (1)
- (3)
- (2)
- (1)
- (1)
- (1)
- (3)
- (1)
- (4)
- (1)
- (1)
- (1)
- (1)
- (1)
- (2)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (2)
- (2)
- (1)
- (1)
- (1)
- (1)
- (2)
- (1)
- (5)
- (1)
- (3)
- (9)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (2)
- (2)
- (1)
- (1)
Filtered Search Results
SAKURA FINETEK USA INC 20X26X5MM
NC2871235 20X26X5MM
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
PHYTO AB INC PsaD Antibody Immunogen: AT1G03130, AT4G02770 Background: PsaD subunit, which is located at the stromal surface of the PSI, is thought to be the docking site of ferredoxi. 150ug/EA
PhytoAB Inc. is a contract research organization and plant antibody R&D based services and products supplier. PhytoAB is privately owned company headquatered in the San Francisco Bay Area of California, USA. PhytoAB specializes in antibody production for plant scientic usage and customized services, focus on the current need of plant antibodies to assist the further investigation of the current booming results from deep genome sequencing and increasing protomics studies. We have specialized R&D and customer services teams to fulfill the needs of botany & plant sciences research and industry world wide with high quality, professional and cutting edge services, and offering complete products usage guidance and suggestions for related problem solutions.
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
PHYTO AB INC PSBB Antibody Immunogen: ATCG00680 Background: CP47 is one of the components of the core complex of PSII. 150ug/EA
PhytoAB Inc. is a contract research organization and plant antibody R&D based services and products supplier. PhytoAB is privately owned company headquatered in the San Francisco Bay Area of California, USA. PhytoAB specializes in antibody production for plant scientic usage and customized services, focus on the current need of plant antibodies to assist the further investigation of the current booming results from deep genome sequencing and increasing protomics studies. We have specialized R&D and customer services teams to fulfill the needs of botany & plant sciences research and industry world wide with high quality, professional and cutting edge services, and offering complete products usage guidance and suggestions for related problem solutions.
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
PHYTO AB INC PHYB Antibody Immunogen: AT2G18790 Background: PHYB is a red far red photoreceptor involved in the regulation of de-etiolation. It exists in two inter-convertible forms Pr and Pfr (active). 150ug/EA
PhytoAB Inc. is a contract research organization and plant antibody R&D based services and products supplier. PhytoAB is privately owned company headquatered in the San Francisco Bay Area of California, USA. PhytoAB specializes in antibody production for plant scientic usage and customized services, focus on the current need of plant antibodies to assist the further investigation of the current booming results from deep genome sequencing and increasing protomics studies. We have specialized R&D and customer services teams to fulfill the needs of botany & plant sciences research and industry world wide with high quality, professional and cutting edge services, and offering complete products usage guidance and suggestions for related problem solutions.
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
PHYTO AB INC PsaB Antibody Immunogen: ATCG00340 Background: The core of the PSI reaction center is formed by polypeptides PSI-A and PSI-B. PsaB is a core protein of PSI complex. 150ug/EA
PhytoAB Inc. is a contract research organization and plant antibody R&D based services and products supplier. PhytoAB is privately owned company headquatered in the San Francisco Bay Area of California, USA. PhytoAB specializes in antibody production for plant scientic usage and customized services, focus on the current need of plant antibodies to assist the further investigation of the current booming results from deep genome sequencing and increasing protomics studies. We have specialized R&D and customer services teams to fulfill the needs of botany & plant sciences research and industry world wide with high quality, professional and cutting edge services, and offering complete products usage guidance and suggestions for related problem solutions.
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
PHYTO AB INC YCF3 Antibody Immunogen: ATCG00360 Background: YCF3 is essential for the assembly of the photosystem I (PSI) complex. 150ug/EA
PhytoAB Inc. is a contract research organization and plant antibody R&D based services and products supplier. PhytoAB is privately owned company headquatered in the San Francisco Bay Area of California, USA. PhytoAB specializes in antibody production for plant scientic usage and customized services, focus on the current need of plant antibodies to assist the further investigation of the current booming results from deep genome sequencing and increasing protomics studies. We have specialized R&D and customer services teams to fulfill the needs of botany & plant sciences research and industry world wide with high quality, professional and cutting edge services, and offering complete products usage guidance and suggestions for related problem solutions.
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
PHYTO AB INC PsbD Antibody Immunogen: ATCG00270 Background: The D1/D2 reaction center heterodimer binds P680, the primary electron donor of PSII as well as several subsequent electron acceptors. 150ug/EA
PhytoAB Inc. is a contract research organization and plant antibody R&D based services and products supplier. PhytoAB is privately owned company headquatered in the San Francisco Bay Area of California, USA. PhytoAB specializes in antibody production for plant scientic usage and customized services, focus on the current need of plant antibodies to assist the further investigation of the current booming results from deep genome sequencing and increasing protomics studies. We have specialized R&D and customer services teams to fulfill the needs of botany & plant sciences research and industry world wide with high quality, professional and cutting edge services, and offering complete products usage guidance and suggestions for related problem solutions.
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
ABI SCIENTIFIC INC QTVTLLPAADLDDFSKQLQQSMSRADSTQA
NC3731548 QTVTLLPAADLDDFSKQLQQSMSRADSTQA
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
BUEHLER LTD 100HRR
NC2874123 100HRR
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
OriGene NM033130
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
NC3885496 NM033130
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
GRAINGER INC ANCHORS 8-10-12 PLASTIC PK100
502791322 ANCHORS 8-10-12 PLASTIC PK100
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
ICHORBIO LTD BROLUCIZUMAB BIOSIMILAR 2X5MG
NC3739876 BROLUCIZUMAB BIOSIMILAR 2X5MG
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
GRAINGER INC STANDARD TRAY 10 IN H
502787536 STANDARD TRAY 10 IN H
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Thomas Scientific THOMAS SCIENTIFIC
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
5000565550 CELL 340-750NM 1.5ML/ POLYSTYR
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
ADVANCED INSTRUMENTS LLC PLASPROXY QUALASSUREA
NC3316202 PLASPROXY QUALASSUREA
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More