Mouse Secondary Antibodies
CPC Scientific H-Ser-Gln-Asp-Ser-Ala-Phe-Arg-Ile-Gln-Glu-Arg-Leu-Arg-Asn-Ser-Lys-Met-Ala-His-Ser-Ser-Ser-Cys-Phe-Gly-Gln-Lys-Ile-Asp-Arg-Ile-Gly-Ala-Val-Ser-Arg-Leu-Gly-Cys-Asp-Gly-Leu-Arg-Leu-Phe-OH (trifluoroacetate salt) 0.5MG
ONE-LETTER SEQUENCE: SQDSAFRIQERLRNSKMAHSSSCFGQKIDRIGAVSRLGCDGLRLF (Cys23 and 39 bridge)MOLECULAR FORMULA: C213H349N71O65S3MOLECULAR WEIGHT:5040.8STORAGE CONDITIONS: -20 5C, CAS REGISTRY NUMBER: [123337-89-3], SYNONYMS: BNP-45 (rat), Brain Natriuretic Peptide-45 (rat)RESEARCH AREA: CardiovascularREFERENCES: M. Aburaya et al., BBRC, 163, 226 (1989)
Immunology Consultants Affinity Purified Goat anti-Rat IgE Antibody, 0.5 mg
Goats were immunized with highly purified rat IgE and the resulting antiserum was collected. Antibody was solid phase adsorbed then immunoaffinity purified off a rat IgE containing immunosorbent. Antibody concentration was determined using an absorbance at 280 nm: 1.4 equals 1.0 mg of IgG. This antibody reacts with rat IgE as determined by IEP and ELISA techniques. It is suitable for blotting, ELISA and IHC applications. This antibody may cross react with IgE from other species. Optimal working dilutions should be determined experimentally by the investigator.
Apexbio Technology LLC Orexin A (human, rat, mouse)(Synonyms: Hypocretin-1, Hcrt-1, Orexin-A, Orexin 1, Hypocretin 1 (human, rat, mouse), OXA), 1mg, CAS: 205640-90-0.
Orexin A (human rat mouse CAS 205640-90-0) is a hypothalamic neuropeptide composed of 33 amino acids functioning as an endogenous agonist at orexin-1 and orexin-2 receptors Binding to these G-protein coupled receptors orexin A regulates multiple physiological processes including appetite arousal states locomotion hypothalamic-pituitary-adrenal axis activity and pain perception thresholds Preclinical studies have demonstrated that intravenous administration of orexin A (3 30 mg/kg) significantly increases paw withdrawal latency in thermal nociception assays suggestive of analgesic potential Hence orexin A serves as a useful tool for investigating neuroendocrine control mechanisms and corresponding therapeutic targets
Medchemexpress LLC Anti-Mouse Rat Human 1mg | 1mg
Anti-Mouse/Rat/Human Osteopontin/SPP1 Antibody (MPIIIB10) is a mouse-derived Osteopontin/SPP1 IgG1 type antibody inhibitor Anti-Mouse/Rat/Human Osteopontin/SPP1 Antibody (MPIIIB10) blocks Angiotensin II (HY-13948)-induced DNA synthesis and collagen gel contraction in cardiac fibroblasts Anti-Mouse/Rat/Human Osteopontin/SPP1 Antibody (MPIIIB10) significantly inhibits tumor growth in CT26 or MC38 tumors mice models[1][2][3]
Jackson Immuno Research Labs Alexa Fluor 488-AffiniPure F(ab')2 Fragment Mouse Anti-Rat IgG (H+L) (min X Hu Bov Hrs Ms Gt Rb Sr Prot)
Alexa Fluor 488-AffiniPure F(ab')2 Fragment Mouse Anti-Rat IgG (H+L) (min X Hu Bov Hrs Ms Gt Rb Sr Prot)
Jackson Immuno Research Labs Alexa Fluor 647-AffiniPure F(ab')2 Fragment Mouse Anti-Rat IgG (H+L) (min X Hu Bov Hrs Ms Gt Rb Sr Prot)
Alexa Fluor 647-AffiniPure F(ab')2 Fragment Mouse Anti-Rat IgG (H+L) (min X Hu Bov Hrs Ms Gt Rb Sr Prot)
Jackson Immuno Research Labs Biotin-SP-AffiniPure Mouse Anti-Rat IgG (H+L) (min X Hu Bov Hrs Ms Gt Rb Sr Prot)
Biotin-SP-AffiniPure Mouse Anti-Rat IgG (H+L) (min X Hu Bov Hrs Ms Gt Rb Sr Prot)
Cayman Chemical Cy5-YntrIethylamIn salt 25mg
A clickable fluorescent probe; ex/em = 650/680 nm, respectively; when peptide-conjugated, it has been used as a pH-independent fluorescent probe for the activity of lysosomal cathepsin proteases in S. typhimurium-infected and bystander BMDMs
Jackson Immuno Research Labs AMCA-AffiniPure F(ab')2 Fragment Mouse Anti-Rat IgG (H+L) (min X Hu Bov Hrs Ms Gt Rb Sr Prot)
AMCA-AffiniPure F(ab')2 Fragment Mouse Anti-Rat IgG (H+L) (min X Hu Bov Hrs Ms Gt Rb Sr Prot)
Jackson Immuno Research Labs Rhodamine Red-X-AffiniPure Mouse Anti-Rat IgG Fcγ Fragment Specific (min X Hu Bov Hrs Ms Sr Prot)
Rhodamine Red-X-AffiniPure Mouse Anti-Rat IgG Fcγ Fragment Specific (min X Hu Bov Hrs Ms Sr Prot)
Creative Biolabs Anti-Mouse CXCL13 Recombinant scFv Fragment, 2C4, 1 mg, Unconjugated, High affinity, ELISA application
This technical summary describes the Anti-Mouse CXCL13 Recombinant Antibody, clone 2C4, supplied by Creative Biolabs. This recombinant single-chain variable fragment (scFv) antibody is engineered for high affinity and specificity to mouse CXCL13. It is a valuable tool for scientific research, particularly for the detection and inhibition of mouse CXCL13 activity. Its inhibitory capabilities make it potentially useful in studies related to disorders where CXCL13 activity is detrimental.
- Target: Mouse CXCL13
- Clone: 2C4
- Antibody type: Recombinant scFv fragment
- Reactivity: Mouse
- Affinity: High
- Application: ELISA
- Function: Detection of mouse CXCL13
- Function: Inhibition of mouse CXCL13 activity
- Quantity: 1 mg
- Conjugation: Unconjugated
Revvity Health Sciences Inc AlphaLISA Bovine IgG2 Detection Kit, Standard
AlphaLISA Bovine IgG2 Detection Kit, Standard