Rat Secondary Antibodies
Biotium Primary Antibody CD81 NA ExoBrite 640 660 1/EA
ExoBrite 640/660 CD81 anti-mouse Flow Antibody is optimized for detection of the exosome marker CD81 in isolated exosomes by flow cytometry The conjugate has Ex/Em at 640/660 nm Recommended for instruments optimized for small particle flow 100 tests
Jackson Immuno Research Labs Alexa Fluor 594-AffiniPure Rat Anti-Mouse IgG (H+L) (min X Hu Bov Hrs Rb Rat Sr Prot)
Alexa Fluor 594-AffiniPure Rat Anti-Mouse IgG (H+L) (min X Hu Bov Hrs Rb Rat Sr Prot)
![Abcam Rat monoclonal [SB77e] Anti-Mouse IgG1 H&L (HRP) preadsorbed](https://assets.fishersci.com/TFS-Assets/CCG/product-images/NC1634564.png-250.jpg)
Abcam Rat monoclonal [SB77e] Anti-Mouse IgG1 H&L (HRP) preadsorbed
Rat monoclonal [SB77e] Anti-Mouse IgG1 H&L (HRP) preadsorbed
The product is subject to the following: Abcam Restricted Use Statement
ABclonal Technology 647 anti-Human CD90/Thy1
This gene encodes a cell surface glycoprotein and member of the immunoglobulin superfamily of proteins The encoded protein is involved in cell adhesion and cell communication in numerous cell types but particularly in cells of the immune and nervous systems The encoded protein is widely used as a marker for hematopoietic stem cells This gene may function as a tumor suppressor in nasopharyngeal carcinoma Alternative splicing results in multiple transcript variants
ABclonal Technology PE/Cyanine7 anti-h CD90/Thy1
This gene encodes a cell surface glycoprotein and member of the immunoglobulin superfamily of proteins The encoded protein is involved in cell adhesion and cell communication in numerous cell types but particularly in cells of the immune and nervous systems The encoded protein is widely used as a marker for hematopoietic stem cells This gene may function as a tumor suppressor in nasopharyngeal carcinoma Alternative splicing results in multiple transcript variants
CPC Scientific H-Asn-Ser-Lys-Met-Ala-His-Ser-Ser-Ser-Cys-Phe-Gly-Gln-Lys-Ile-Asp-Arg-Ile-Gly-Ala-Val-Ser-Arg-Leu-Gly-Cys-Asp-Gly-Leu-Arg-Leu-Phe-OH (trifluoroacetate salt) 1MG
Brain natriuretic peptide or B-type natriuretic peptide (BNP) (also ventricular natriuretic peptide) is a 32-amino acid peptide secreted by heart ventricles in response to excessive stretching of heart muscle cells (cardiomyocytes).ONE-LETTER SEQUENCE: NSKMAHSSSCFGQKIDRIGAVSRLGCDGLRLF (Cys10 and 26 bridge)MOLECULAR FORMULA: C146H239N47O44S3MOLECULAR WEIGHT:3453STORAGE CONDITIONS: -20 5C, CAS REGISTRY NUMBER: [133448-20-1], RESEARCH AREA: CardiovascularREFERENCES: M. Kojima et al., BBRC, 159, 1420 (1989)
