Protein Labeling Reagents
Revvity Health Sciences Inc IVISense 750 MAL Fluorescent Self-Quenching Dye (5 mg) (VivoTag)
IVISense 750 MAL Fluorescent Self-Quenching Dye (5 mg) (VivoTag)
Revvity Health Sciences Inc IVISense Transferrin Receptor 750 Fluorescent Probe (Transferrin-Vivo)
IVISense Transferrin Receptor 750 Fluorescent Probe (Transferrin-Vivo)
Dojindo Molecular Technologies Inc PlasMem Bright Green dye (100 ul) offers plasma membrane staining for 24 hrs+ with clear visualization, high retentivity, low toxicity, water-soluble, no washing, applicable to live and fixed cells.
The plasma membrane consists of a lipid bilayer separating the intracellular environment from the extracellular space. Thus, the PM plays a central role in many cell behaviors such as cell migration, cell stretching, and signaling cascades. Additionally, PM dysfunction is an important biomarker because it is related to cell status and is linked to many diseases. PlasMem Bright dyes have higher retentivity on the plasma membrane. Furthermore, PlasMem Bright dyes are more water-soluble compared with other commercially available dyes and can be diluted with the culture medium. The PlasMem Bright dyes offer two different color options (green and red) and provide ready-to-use DMSO solutions. A working solution can be prepared easily via a single dilution step using growth medium or HBSS. Dojindo offers various reagents for cell membrane research. (https://www.dojindo.com/track-the-dynamics-of-plasma-membrane/)
CPC Scientific 5FAM-Ser-Pro-Lys-Met-Val-Gln-Gly-Ser-Gly-Cys-Phe-Gly-Arg-Lys-Met-Asp-Arg-Ile-Ser-Ser-Ser-Ser-Gly-Leu-Gly-Cys-Lys-Val-Leu-Arg-Arg-His-OH (trifluoroacetate salt) 1MG
Brain natriuretic peptide or B-type natriuretic peptide (BNP) (also ventricular natriuretic peptide) is a 32-amino acid peptide secreted by heart ventricles in response to excessive stretching of heart muscle cells (cardiomyocytes).ONE-LETTER SEQUENCE: 5FAM-SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH (Cys10 and 26 bridge)MOLECULAR FORMULA: C164H256N50O48S4MOLECULAR WEIGHT:3824.4STORAGE CONDITIONS: -20 5C, CAS REGISTRY NUMBER: [114471-18-0], RESEARCH AREA: CardiovascularREFERENCES: T. Sudoh et al., BBRC, 159, 1427 (1989)
CPC Scientific TAMRA-Ser-Pro-Lys-Met-Val-Gln-Gly-Ser-Gly-Cys-Phe-Gly-Arg-Lys-Met-Asp-Arg-Ile-Ser-Ser-Ser-Ser-Gly-Leu-Gly-Cys-Lys-Val-Leu-Arg-Arg-His-OH (trifluoroacetate salt) 0.5MG
Brain natriuretic peptide or B-type natriuretic peptide (BNP) (also ventricular natriuretic peptide) is a 32-amino acid peptide secreted by heart ventricles in response to excessive stretching of heart muscle cells (cardiomyocytes).ONE-LETTER SEQUENCE: TAMRA-SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH (Cys10 and 26 bridge)MOLECULAR FORMULA: C168H266N52O46S4MOLECULAR WEIGHT:3878.6STORAGE CONDITIONS: -20 5C, CAS REGISTRY NUMBER: [114471-18-0], RESEARCH AREA: CardiovascularREFERENCES: T. Sudoh et al., BBRC, 159, 1427 (1989)
![eMolecules Broadpharm / BP Light 800 NHS ester / 1mg / 599128602 / BP-25546 / / 2006309-79-9 / [null] / 540.550 / C25H27F3N2O6S](https://assets.fishersci.com/TFS-Assets/CCG/product-images/502471234.JPG-250.jpg)
eMolecules Broadpharm / BP Light 800 NHS ester / 1mg / 599128602 / BP-25546 / / 2006309-79-9 / [null] / 540.550 / C25H27F3N2O6S
Broadpharm / BP Light 800 NHS ester / 1mg / 599128602 / BP-25546 / / 2006309-79-9 / [null] / 540.550 / C25H27F3N2O6S
Biocare Medical, LLC Romulin AEC Chromogen Kit - 500 ml
AEC is a widely used chromogen for immunohistochemical procedures. In the past, AEC chromogens required a water-soluble mounting media because it was soluble in organic solvents. Romulin AEC from Biocare produces a reddish-orange stain. However, it is not soluble in alcohol or xylene-and can be coverslipped just like DAB. It does not fade with permanent mounting media such as PermountTM. When in the presence of a peroxidase enzyme, Romulin AEC produces a reddish-orange stain. This product comes in a 4-component system consisting of ready-to-use buffer, stabilizer, chromogen and hydrogen peroxide.
Chondrex Inc TRITC-DEXTRAN, 125 MG, 70 KDA
TRITC-Dextran (70 kDa) solution, 25 mg/mL x 5 mL, in PBS (red color). Fluorescent Properties: Excitation - 550 nm, Emission - 572 nm.
Cayman Chemical Botn-HPDP 5mg
A sulfhydryl-reactive biotinylation reagent that forms a reversible disulfide linkage, used to label protein cysteines and other substrates that contain sulfhydryl groups; EAsily linked with target substrates at pH 6.5 to 7.5 in buffers such as PBS; disulfide linkage can be cleaved by reducing agents
CPC Scientific TAMRA-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-OH (trifluoroacetate salt) 0.5MG
Synthetic peptide that forms fibrils with have the same antigenic and structural features as those of native AD amyloid filaments.ONE-LETTER SEQUENCE: TAMRA-DAEFRHDSGYEVHHQKLVFFAEDVGSNKMOLECULAR FORMULA: C170H230N43O50MOLECULAR WEIGHT:3676STORAGE CONDITIONS: -20 5C, CAS REGISTRY NUMBER: [109770-29-8], RESEARCH AREA: Alzheimer's DiseaseREFERENCES: J. Kang et al., Nature, 325, 773 (1987)
CPC Scientific FAM-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-OH (trifluoroacetate salt) 0.5MG
beta-Amyloid (1-40) found to exhibit both neurotrophic and neurotoxic effects that depend on neuronal age and beta-protein concentration.ONE-LETTER SEQUENCE: FAM-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVMOLECULAR FORMULA: C215H305N53O64S1MOLECULAR WEIGHT:4688.2STORAGE CONDITIONS: -20 5C, CAS REGISTRY NUMBER: [1678416-08-4], SYNONYMS: 5-FAM-Amyloid β-Protein (1-40)RESEARCH AREA: Alzheimer's DiseaseREFERENCES: B.A. Yankner et al., Science, 250, 279 (1990)
CPC Scientific TAMRA-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-OH (trifluoroacetate salt) 0.1MG
beta-Amyloid (1-40) found to exhibit both neurotrophic and neurotoxic effects that depend on neuronal age and beta-protein concentration.ONE-LETTER SEQUENCE: TAMRA-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVMOLECULAR FORMULA: C219H315N55O62S1MOLECULAR WEIGHT:4742.4STORAGE CONDITIONS: -20 5C, CAS REGISTRY NUMBER: [1802087-81-5], SYNONYMS: 5-TAMRA-Amyloid β-Protein (1-40)RESEARCH AREA: Alzheimer's DiseaseREFERENCES: B.A. Yankner et al., Science, 250, 279 (1990)