Protein Labeling Reagents
Cayman Chemical CarbaprostacyclIn-bIotIn 100ug
An affinity probe which allows carbaprostacyclin to be detected in complexes with transmembrane receptors and/or nucleic or protein binding partners
CPC Scientific TAMRA-Ser-Pro-Lys-Met-Val-Gln-Gly-Ser-Gly-Cys-Phe-Gly-Arg-Lys-Met-Asp-Arg-Ile-Ser-Ser-Ser-Ser-Gly-Leu-Gly-Cys-Lys-Val-Leu-Arg-Arg-His-OH (trifluoroacetate salt) 1MG
Brain natriuretic peptide or B-type natriuretic peptide (BNP) (also ventricular natriuretic peptide) is a 32-amino acid peptide secreted by heart ventricles in response to excessive stretching of heart muscle cells (cardiomyocytes).ONE-LETTER SEQUENCE: TAMRA-SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH (Cys10 and 26 bridge)MOLECULAR FORMULA: C168H266N52O46S4MOLECULAR WEIGHT:3878.6STORAGE CONDITIONS: -20 5C, CAS REGISTRY NUMBER: [114471-18-0], RESEARCH AREA: CardiovascularREFERENCES: T. Sudoh et al., BBRC, 159, 1427 (1989)
CPC Scientific 5FAM-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-OH (trifluoroacetate salt) 0.5MG
Synthetic peptide that forms fibrils with have the same antigenic and structural features as those of native AD amyloid filaments.ONE-LETTER SEQUENCE: 5FAM-DAEFRHDSGYEVHHQKLVFFAEDVGSNKMOLECULAR FORMULA: C166H219N41O52MOLECULAR WEIGHT:3620.8STORAGE CONDITIONS: -20 5C, CAS REGISTRY NUMBER: [109770-29-8], RESEARCH AREA: Alzheimer's DiseaseREFERENCES: J. Kang et al., Nature, 325, 773 (1987)
CPC Scientific TAMRA-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-OH (trifluoroacetate salt) 0.1MG
Synthetic peptide that forms fibrils with have the same antigenic and structural features as those of native AD amyloid filaments.ONE-LETTER SEQUENCE: TAMRA-DAEFRHDSGYEVHHQKLVFFAEDVGSNKMOLECULAR FORMULA: C170H230N43O50MOLECULAR WEIGHT:3676STORAGE CONDITIONS: -20 5C, CAS REGISTRY NUMBER: [109770-29-8], RESEARCH AREA: Alzheimer's DiseaseREFERENCES: J. Kang et al., Nature, 325, 773 (1987)
Cell Signaling Technology PathScanR Cleaved PARP Asp214 Sandwich ELISA Kit 50 Kit
PathScanR Cleaved PARP Asp214 Sandwich ELISA Kit 50 Kit
Sigma Aldrich Fine Chemicals Biosciences Atto MB2 NHS ester Methyle1MG
Atto MB2 NHS ester is a derivative of the well-known redox dye Methylene Blue. The dye can be reversibly reduced to the colorless leuko form. Upon oxidation (e.g. with oxygen) the dye recovers and the absorption is fully restored.The dye is suitable for labeling of DNA RNA proteins etc. In common with most Atto-labels the dye shows a high extinction coefficient.Atto MB2 NHS ester is moderately hydrophilic.find more information here
Medchemexpress LLC (±)-ANAP hydrochloride | 2308035-47-2 | 98.5% | 308.76 | C15H17ClN2O3 | 10 MG
(±)-ANAP hydrochloride is a fluorescent, unnatural amino-acid analog of prodan used as an environment-sensitive probe in biochemical and biophysical studies. It displays polarity-dependent changes in fluorescence intensity and emission wavelength, allowing monitoring of local microenvironments when incorporated site-specifically into peptides or proteins. The compound is supplied as a solid hydrochloride salt with storage recommendations to minimize exposure to moisture and light.
- Sensitive to polarity with changes in intensity and emission wavelength.
- Suitable for site-specific incorporation into peptides and proteins.
- Enables monitoring of local microenvironmental changes.
- High purity appropriate for research applications.
- Stable as a solid; store sealed away from moisture and light at 4°C.
- Available in small package sizes for screening and synthesis.
![Aat Bioquest Tide Quencher™ 2WS maleimide [TQ2WS maleimide]](https://assets.fishersci.com/TFS-Assets/CCG/product-images/501953054.JPG-250.jpg)
Aat Bioquest Tide Quencher™ 2WS maleimide [TQ2WS maleimide]
TQ2WS is designed to be a superior quencher to FAM, HEX, TET, JOE, TF2 and rhodamine 6G. TQ2WS has (a). much stronger absorption; (b). much higher quenching efficiency; and (c).
