Protein Labeling Reagents
Medchemexpress LLC HY-D0921 5mg Medchemexpress, Heptamethine cyanine dye-1 CAS:162411-29-2 Purity:>98%
Medchemexpress, HY-D0921 5mg Heptamethine cyanine dye-1 CAS:162411-29-2 Heptamethine cyanine dye-1 is a near-infrared cyanine dye for fluorescence imaging in biological systems. Purity:>98% Medchemexpress has over 10000 novel life-science reagents, reference compounds, APIs and natural compounds for laboratory and scientific use. Other quantity can also be offered.
Apexbio Technology LLC Cyclo (-RGDfK), 5mg. Cas: 161552-03-0 MFCD: MFCD00937400. Inhibitor of αvβ3 integrin
In one study where this peptide was labeled with 125I, it was found to bind specifically and with high affinity to v3 receptors on neovascular blood vessel sections of different major human cancers. The integrin alpha(IIb)beta(3)-specific cyclic hexapeptide contains an Arg-Gly-Asp (RGD) sequence. Other sizes are available. Please inqury us for quote.
CPC Scientific TAMRA-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-OH (trifluoroacetate salt) 0.1MG
beta-Amyloid (1-40) found to exhibit both neurotrophic and neurotoxic effects that depend on neuronal age and beta-protein concentration.ONE-LETTER SEQUENCE: TAMRA-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVMOLECULAR FORMULA: C219H315N55O62S1MOLECULAR WEIGHT:4742.4STORAGE CONDITIONS: -20 5C, CAS REGISTRY NUMBER: [1802087-81-5], SYNONYMS: 5-TAMRA-Amyloid β-Protein (1-40)RESEARCH AREA: Alzheimer's DiseaseREFERENCES: B.A. Yankner et al., Science, 250, 279 (1990)
Cayman Chemical AB-005 azepn Isomer 10mg
A variant of AB-005 in which the methylpiperidine group has been replaced with methylazepane; intended for forensic and research applications
![eMolecules Sulfo-Cy7.5 alkyne | Broadpharm |1120.450 | C48H48K3N3O13S4 | 0.000 | [K+].[K+].[K+].CN1\C(=C\C=C2/CCCC(\C=C\C3=[N+](CCCCCC(=O)NCC#C)c4ccc5c(cc(cc5c4C3(C)C)S([O-])(=O)=O)S([O-])(=O)=O)=C2)C(C)(C)c2c1ccc1c(cc(cc21)S([O-])(=O)=O)S([O-])(=O)=O | 1mg | 761705701](https://assets.fishersci.com/TFS-Assets/CCG/product-images/502462211.JPG-250.jpg)
eMolecules Sulfo-Cy7.5 alkyne | Broadpharm |1120.450 | C48H48K3N3O13S4 | 0.000 | [K+].[K+].[K+].CN1\C(=C\C=C2/CCCC(\C=C\C3=[N+](CCCCCC(=O)NCC#C)c4ccc5c(cc(cc5c4C3(C)C)S([O-])(=O)=O)S([O-])(=O)=O)=C2)C(C)(C)c2c1ccc1c(cc(cc21)S([O-])(=O)=O)S([O-])(=O)=O | 1mg | 761705701
Sulfo-Cy7.5 alkyne | Broadpharm |1120.450 | C48H48K3N3O13S4 | 0.000 | [K+].[K+].[K+].CN1\C(=C\C=C2/CCCC(\C=C\C3=[N+](CCCCCC(=O)NCC#C)c4ccc5c(cc(cc5c4C3(C)C)S([O-])(=O)=O)S([O-])(=O)=O)=C2)C(C)(C)c2c1ccc1c(cc(cc21)S([O-])(=O)=O)S([O-])(=O)=O | 1mg | 761705701
Echelon Biosciences Research Labs GloPIPs BODIPY TMR PI(3)P 50 ug
Phosphoinositides (PIPns) are minor components of cellular membranes but are integral signaling molecules for cellular communication. Phosphatidylinositol 3-phosphate (PI(3)P) is enriched in early endosomes having roles in endosome fusion and receptor sorting and internalization in multivesicular bodies. PI(3)P has also been found at the plasma membrane and is involved in the translocation of the glucose transport protein GLUT4.GloPIPs are labeled at the sn-1 position with BODIPY-FL (505/513), BODIPY-TMR (544/574), or biotin. The sn-1 linkage in these labeled PIPs has been changed to a more stable amide from an ester. Results from experiments conducted at Echelon indicated that this minor chemical change did not have a significant effect in any of the applications tested. This item is non returnable
![eMolecules BDP 558/568 amine | Broadpharm |480.810 | C22H28BClF2N4OS | 0.000 | Cl.NCCCCCCNC(=O)CCc1ccc2C=C3C=CC(c4cccs4)=[N+]3[B-](F)(F)n12 | 1mg | 761705797](https://assets.fishersci.com/TFS-Assets/CCG/product-images/502458475.PNG-250.jpg)
eMolecules BDP 558/568 amine | Broadpharm |480.810 | C22H28BClF2N4OS | 0.000 | Cl.NCCCCCCNC(=O)CCc1ccc2C=C3C=CC(c4cccs4)=[N+]3[B-](F)(F)n12 | 1mg | 761705797
BDP 558/568 amine | Broadpharm |480.810 | C22H28BClF2N4OS | 0.000 | Cl.NCCCCCCNC(=O)CCc1ccc2C=C3C=CC(c4cccs4)=[N+]3[B-](F)(F)n12 | 1mg | 761705797
Lumiprobe Sulfo-Cyanine7 azide, 1 mg
A water-soluble NIR dye azide for Click Chemistry. Sulfo-Cyanine7 is a cyanine dye, an analog of Cy7 with improved photophysical properties. This dye is a perfect choice for NIR imaging studies in live organisms.
![eMolecules BDP 650/665 azide | Broadpharm |515.330 | C26H24BF2N7O2 | 0.000 | F[B-]1(F)n2c(ccc2-c2ccc[nH]2)C=C2C=CC(\C=C\c3ccc(OCC(=O)NCCCN=[N+]=[N-])cc3)=[N+]12 | 1mg | 761705624](https://assets.fishersci.com/TFS-Assets/CCG/product-images/502459048.PNG-250.jpg)
eMolecules BDP 650/665 azide | Broadpharm |515.330 | C26H24BF2N7O2 | 0.000 | F[B-]1(F)n2c(ccc2-c2ccc[nH]2)C=C2C=CC(\C=C\c3ccc(OCC(=O)NCCCN=[N+]=[N-])cc3)=[N+]12 | 1mg | 761705624
BDP 650/665 azide | Broadpharm |515.330 | C26H24BF2N7O2 | 0.000 | F[B-]1(F)n2c(ccc2-c2ccc[nH]2)C=C2C=CC(\C=C\c3ccc(OCC(=O)NCCCN=[N+]=[N-])cc3)=[N+]12 | 1mg | 761705624
eMolecules BP Fluor 568 Alkyne | Broadpharm |731.790 | C36H33N3O10S2 | 0.000 | CC1(C)Nc2cc3Oc4cc5=NC(C)(C)C=C(CS(O)(=O)=O)c5cc4=C(c3cc2C(CS(O)(=O)=O)=C1)c1ccc(cc1C(O)=O)C(=O)NCC#C | 25mg | 599128684
BP Fluor 568 Alkyne | Broadpharm |731.790 | C36H33N3O10S2 | 0.000 | CC1(C)Nc2cc3Oc4cc5=NC(C)(C)C=C(CS(O)(=O)=O)c5cc4=C(c3cc2C(CS(O)(=O)=O)=C1)c1ccc(cc1C(O)=O)C(=O)NCC#C | 25mg | 599128684
LICOR IRDye 680RD NHS Ester (50 mg)
IRDye infrared dyes from LI-COR Biosciences are available for researchers developing applications using near-infrared (NIR) fluorescence. These unique dyes are used in a variety of NIR imaging applications including Western blotting, plate-based assays, protein arrays, tissue section imaging, and molecular activity measurements. Standard NHS ester chemistry is used to produce custom probes labeled with LI-COR IRDye infrared dyes. The NHS ester reactive group provides the functionality for labeling primary and secondary amines, such as lysine residues in proteins.
eMolecules 943298-08-6 | Medchem Express | CY7 | 5mg | 446274316 | HY-D0825 | MFCD26743748 | 682.85 | C35H42N2O8S2
Medchem Express | CY7 | 5mg | 446274316 | HY-D0825 | 943298-08-6 | MFCD26743748 | 682.850 | C35H42N2O8S2
AdipoGen Fluorescein dipalmitate
Chemical. CAS 7262-38-6. Formula C52H72O7. MW 809.12. Fluorescein dipalmitate is a non-fluorescent hydrophobic fluorescein derivative that can pass through the cell membrane whereupon intracellular esterases hydrolyze the dipalmitate group producing the highly fluorescent product fluorescein. The fluorescein molecules accumulate in cells. Fluorescein dipalmitate is a fluorogenic substrate for C16 esterase that generates green fluorescence upon esterase cleavage. Spectral Data lambdaEx 497nM, lambdaEm 516nm. Extinction coefficient 80000 cm-1 M-1.
Cayman Chemical AM2201 2-naphthyl Isomer 5mg
Differs structurally from AM2201 by having the naphthyl group attached at the 2' position