Protein Labeling Reagents
CPC Scientific 5FAM-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-OH (trifluoroacetate salt) 0.5MG
Synthetic peptide that forms fibrils with have the same antigenic and structural features as those of native AD amyloid filaments.ONE-LETTER SEQUENCE: 5FAM-DAEFRHDSGYEVHHQKLVFFAEDVGSNKMOLECULAR FORMULA: C166H219N41O52MOLECULAR WEIGHT:3620.8STORAGE CONDITIONS: -20 5C, CAS REGISTRY NUMBER: [109770-29-8], RESEARCH AREA: Alzheimer's DiseaseREFERENCES: J. Kang et al., Nature, 325, 773 (1987)
Apexbio Technology LLC Cy3.5 maleimide (non-sulfonated), 5mg. Cas: N/A MFCD: NA. Labeling of cysteine residues, as well as other thiolated molecules
Cy3.5 maleimide can be used for selective labeling of free sulfhydryl groups (e.g. cysteine residues in peptides, proteins and oligonucleotides). Before labeling, cystines should be prepared with reductant such as TCEP (tris-carboxyethylphosphine). Other sizes are available. Please inqury us for quote.
Medchemexpress LLC (±)-ANAP hydrochloride | 2308035-47-2 | 98.5% | 308.76 | C15H17ClN2O3 | 10 MG
(±)-ANAP hydrochloride is a fluorescent, unnatural amino-acid analog of prodan used as an environment-sensitive probe in biochemical and biophysical studies. It displays polarity-dependent changes in fluorescence intensity and emission wavelength, allowing monitoring of local microenvironments when incorporated site-specifically into peptides or proteins. The compound is supplied as a solid hydrochloride salt with storage recommendations to minimize exposure to moisture and light.
- Sensitive to polarity with changes in intensity and emission wavelength.
- Suitable for site-specific incorporation into peptides and proteins.
- Enables monitoring of local microenvironmental changes.
- High purity appropriate for research applications.
- Stable as a solid; store sealed away from moisture and light at 4°C.
- Available in small package sizes for screening and synthesis.
CPC Scientific 5FAM-Ser-Pro-Lys-Met-Val-Gln-Gly-Ser-Gly-Cys-Phe-Gly-Arg-Lys-Met-Asp-Arg-Ile-Ser-Ser-Ser-Ser-Gly-Leu-Gly-Cys-Lys-Val-Leu-Arg-Arg-His-OH (trifluoroacetate salt) 1MG
Brain natriuretic peptide or B-type natriuretic peptide (BNP) (also ventricular natriuretic peptide) is a 32-amino acid peptide secreted by heart ventricles in response to excessive stretching of heart muscle cells (cardiomyocytes).ONE-LETTER SEQUENCE: 5FAM-SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH (Cys10 and 26 bridge)MOLECULAR FORMULA: C164H256N50O48S4MOLECULAR WEIGHT:3824.4STORAGE CONDITIONS: -20 5C, CAS REGISTRY NUMBER: [114471-18-0], RESEARCH AREA: CardiovascularREFERENCES: T. Sudoh et al., BBRC, 159, 1427 (1989)
