Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Medchemexpress LLC Adrenomedullin (human) (TFA) | 99.9% | 6028.82 (free base) | 500 UG
Supplier: Medchemexpress LLC HYP1455A500UG
Adrenomedullin (AM) (1-52), human (TFA) is a peptide that affects cell proliferation and angiogenesis in cancer. This product is provided as a white to off-white solid and is intended for research use only.
- Purity: 99.94%
- Molecular weight: 6028.82 (free base)
- Sequence: YRQSMNNFQGLRSFGCRFGTCTVQKLAHQIYQFTDKDKDNVAPRSKISPQGY-NH2 (Disulfide bridge: Cys16-Cys21)
- Affects cell proliferation and angiogenesis in cancer
- Store sealed, away from moisture and light
- Powder storage: -80°C for 2 years, -20°C for 1 year
- In solvent storage: -80°C for 6 months, -20°C for 1 month
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?