Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. NC0501493

AnaSpec B AMYLOIED (1-40) HILYTE FLUR

Supplier:  AnaSpec AS6049101

Encompass

Beta-Amyloid (1-40), HiLyte(TM) Fluor 488-labeled, Human[HiLyte(TM) Fluor 488-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV] ; MW 4686.3; (0.1 mg) This is a fluorescent (HiLyte(TM) Fluor 488)-labeled B-Amyloid peptide, Abs/Em=503/528 nm.

Catalog No. NC0501493


May include imposed supplier surcharges.
Only null left
Add to Cart

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.