Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

CPC Scientific H-Cys-Ala-Ser-Leu-Ser-Thr-Cys-Val-Leu-Gly-Lys-Leu-Ser-Gln-Glu-Leu-His-Lys-Leu-Gln-Thr-Tyr-Pro-Arg-Thr-Asp-Val-Gly-Ala-Gly-Thr-Pro-NH2 (trifluoroacetate salt) 0.5MG
SDP

Supplier:  CPC Scientific OSTP016A

Encompass

Single chain peptide with 32 amino acids that stimulates bone formation by inhibiting osteoblasts, induces bone reabsorption and increases cAMP levels in osteoclasts.ONE-LETTER SEQUENCE: CASLSTCVLGKLSQELHKLQTYPRTDVGAGTP-NH2 (Cys1 and 7 bridge)MOLECULAR FORMULA: C145H240N42O46S2MOLECULAR WEIGHT:3371.9STORAGE CONDITIONS: -20 5C, CAS REGISTRY NUMBER: [100016-62-4], RESEARCH AREA: OsteoporosisREFERENCES: T. Kurihara et al., Peptide Chemistry, 1985, 173 (1986)

Catalog No. 50-211-0027


May include imposed supplier surcharges.
Only null left
Add to Cart

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.