Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. 502108807

CPC Scientific H-Lys-Trp-Lys-Leu-Phe-Lys-Lys-Ile-Glu-Lys-Val-Gly-Gln-Asn-Ile-Arg-Asp-Gly-Ile-Ile-Lys-Ala-Gly-Pro-Ala-Val-Ala-Val-Val-Gly-Gln-Ala-Thr-Gln-Ile-Ala-Lys-NH2 (trifluoroacetate salt) 1MG
SDP

Supplier:  CPC Scientific ATMP001B

Encompass

37-residue peptide possessing antibacterial activity against Escherichia coli, pseudomonas aeruginosa, bacillus megaterium and micrococcus luteus at micromolar concentrations. ONE-LETTER SEQUENCE: KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK-NH2MOLECULAR FORMULA: C184H313N53O46MOLECULAR WEIGHT:4003.8STORAGE CONDITIONS: -20 5C, CAS REGISTRY NUMBER: [80451-04-3], RESEARCH AREA: AntimicrobialREFERENCES: D. Andreu et al., Proc. 20th Euro. Pept. Symp., 361 (1988 )

Catalog No. 50-210-8807


May include imposed supplier surcharges.
Only null left
Add to Cart

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.