Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

CPC Scientific H-Asp-Cys-Tyr-Cys-Arg-Ile-Pro-Ala-Cys-Ile-Ala-Gly-Glu-Arg-Arg-Tyr-Gly-Thr-Cys-Ile-Tyr-Gln-Gly-Arg-Leu-Trp-Ala-Phe-Cys-Cys-OH (trifluoroacetate salt) 1MG
SDP

Supplier:  CPC Scientific DEFS007C

Encompass

This peptide contain 6 conserved disulfide-linked cysteines. In vitro, it has a prominent antimicrobial activities against bacteria, fungi, and certain enveloped viruses. In addition, human and rabbit defensins exert potent cytotoxicity in vitro against various mammalian tumor cells.SEQUENCE: H-Asp-Cys-Tyr-Cys-Arg-Ile-Pro-Ala-Cys-Ile-Ala-Gly-Glu-Arg-Arg-Tyr-Gly-Thr-Cys-Ile-Tyr-Gln-Gly-Arg-Leu-Trp-Ala-Phe-Cys-Cys-OH (trifluoroacetate salt)(Cys2 and Cys30/Cys4 and Cys19/Cys9 and Cys29 Bridge)ONE-LETTER SEQUENCE: DCYCRIPACIAGERRYGTCIYQGRLWAFCC(Cys2 and Cys30/Cys4 and Cys19/Cys9 and Cys29 Bridge)MOLECULAR FORMULA: C151H222N44O40S6MOLECULAR WEIGHT: 3486.09STORAGE CONDITIONS: -20 5 CCAS REGISTRY NUMBER: [136661-76-2]SYNONYMS: RESEARCH AREA: AntimicrobialCATEGORY: Defensins REFERENCES:P.A.Raj et al., Biochem. J., 347, 633 (2000)F.T.Lundy et al., Oral Oncol., 40, 139 (20

Catalog No. 50-210-9195


May include imposed supplier surcharges.
Only null left
Add to Cart

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.