Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. 502988221

Cayman Chemical EP4 ReceptrC-Term BlockIn 1ea
SDP

Catalog No. 502988221
Encompass_Preferred

Peptide Sequence: human EP4 receptor sequence amino acids 459-488 (GSGRAGPAPKGSSLQVTFPSETLNLSEKCI) · To be used in conjunction with Cayman’s EP4 Receptor Polyclonal Antibody (Item No. 101775) to block protein-antibody complex formation during immunochemical analysis for the EP4 receptor.

Catalog No. 50-298-8221 Supplier Cayman Chemical Supplier No. 3017751 EA
May include imposed supplier surcharges.
Add to Cart
Add to Cart

missing translation for 'validMainframeMsg'

Peptide Sequence: human EP4 receptor sequence amino acids 459-488 (GSGRAGPAPKGSSLQVTFPSETLNLSEKCI) · To be used in conjunction with Cayman’s EP4 Receptor Polyclonal Antibody (Item No. 101775) to block protein-antibody complex formation during immunochemical analysis for the EP4 receptor.

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.