Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

CPC Scientific H-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2 0.5MG
SDP

Supplier:  CPC Scientific EXED004A

Encompass

Potent glucagon-like peptide (GLP-1) receptor antagonist.SEQUENCE: H-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2ONE-LETTER SEQUENCE: EGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2MOLECULAR FORMULA: C176H272N46O58S1MOLECULAR WEIGHT: 3992.46STORAGE CONDITIONS: -20 5 CCAS REGISTRY NUMBER: [196109-31-6]SYNONYMS: RESEARCH AREA: DiabetesREFERENCES:SKU(s): EXED-004A, EXED-004B

Catalog No. 50-210-9267


May include imposed supplier surcharges.
Add to Cart

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.