Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. 501686481

Carbosynth LLC. Exendin-4, 1mg, Sequence originally isolated from venom derived from the modified salivary glands of the Gila monster (Heloderma suspectum)., MW: (M.W. 4186.66), Molecular formula: C184H282N50O60S, CAS# [141758-74-9]
SDP

Supplier:  Carbosynth LLC. PEX3784PI1MG

Encompass_Preferred

Synonyms: H-His-Gly-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2, exenatide, H-HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2, Application: GLP-1 (Glucagon-Like Peptide-1) Receptor Agonist, Storage Temperature: -20°C, References: R Göke, et al., J Biol Chem., 26, 19650 (1993)., B. Thorens, et al., Diabetes, 42, 1678, (1993)., A. Alcántara, et al., Arch Biochem Biophys., 341, 1, (1997).

Catalog No. 50-168-6481


May include imposed supplier surcharges.
Add to Cart

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.