Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. 502108660

CPC Scientific FAM-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-OH (trifluoroacetate salt) 0.5MG
SDP

Supplier:  CPC Scientific AMYD011B

Encompass

beta-Amyloid (1-40) found to exhibit both neurotrophic and neurotoxic effects that depend on neuronal age and beta-protein concentration.ONE-LETTER SEQUENCE: FAM-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVMOLECULAR FORMULA: C215H305N53O64S1MOLECULAR WEIGHT:4688.2STORAGE CONDITIONS: -20 5C, CAS REGISTRY NUMBER: [1678416-08-4], SYNONYMS: 5-FAM-Amyloid β-Protein (1-40)RESEARCH AREA: Alzheimer's DiseaseREFERENCES: B.A. Yankner et al., Science, 250, 279 (1990)

Catalog No. 50-210-8660


May include imposed supplier surcharges.
Only null left
Add to Cart

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.