Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Medchemexpress LLC FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS | 98.01% | 3692.15 | 5 MG
Supplier: Medchemexpress LLC HYP12295MG
FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative that functions as a pure GLP-1 receptor agonist. These derivatives are structurally related to Exendin-4 and may also act as dual GLP-1/glucagon receptor agonists. They are of interest for medical use, particularly in the treatment of metabolic syndrome disorders such as diabetes and obesity, and for reducing excessive food intake.
- Acts as a pure GLP-1 receptor agonist
- Structurally derived from Exendin-4
- Potential as a dual GLP-1/glucagon receptor agonist
- May be used to treat metabolic syndrome disorders, including diabetes and obesity
- Can help reduce excess food intake
- Shows reduced activity on the GIP receptor to mitigate hypoglycemia risk
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?