Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
AnaSpec LL37 PEPTIDE 1MG
Supplier: AnaSpec AS61302
LL-37, Antimicrobial Peptide, human[[LL-37, 37 aa]] ; MW 4493.3; (1 mg) Antimicrobial peptide LL-37,� belonging� to the cathelicidin family, �is the first amphipathic alpha-helical peptide isolated from human.��It plays�an important role in the first line of defense against local infection and systemic invasion of pathogens at sites of inflammation and wounds.��Cytotoxic to both bacterial and normal eukaryotic cells�, LL-37�is significantly resistant to proteolytic degradation in solution.�
Product Suggestions
Customers who viewed this item also viewed
Viewing 1-5 of 10
-
Catalog No. PI23209
$107.65 / Pack of 10Save 34% Reg: $161.90 -
Catalog No. PI23227
$186.65 / EachSave 31% Reg: $272.00 -
Catalog No. PI89900
$225.50 / Each -
Catalog No. PI78440
$411.50 / Each -
Catalog No. PI87786
$221.00 / Each -
Catalog No. PI34028
$224.65 / EachSave 29% Reg: $318.00 -
Catalog No. BDB564220
$198.00 / Each -
-
Catalog No. AAJ66506EXF
$274.00 / Each -
Catalog No. 50-824-468
$374.76 / Each
Product Content Correction
The Fisher Scientific Encompass Program offers items which are not part of our distribution portfolio. These products typically do not have pictures or detailed descriptions. However, we are committed to improving your shopping experience. Please use the form below to provide feedback related to the content on this product.
Product Title
AnaSpec LL37 PEPTIDE 1MG
Spot an opportunity for improvement?Share a Content Correction