Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

AnaSpec LL37 PEPTIDE 1MG

Supplier:  AnaSpec AS61302

Encompass

LL-37, Antimicrobial Peptide, human[[LL-37, 37 aa]] ; MW 4493.3; (1 mg) Antimicrobial peptide LL-37,� belonging� to the cathelicidin family, �is the first amphipathic alpha-helical peptide isolated from human.��It plays�an important role in the first line of defense against local infection and systemic invasion of pathogens at sites of inflammation and wounds.��Cytotoxic to both bacterial and normal eukaryotic cells�, LL-37�is significantly resistant to proteolytic degradation in solution.�

Catalog No. NC9896470


May include imposed supplier surcharges.
Only null left
Add to Cart

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.