Learn More
AnaSpec LL37 PEPTIDE 1MG
Supplier: AnaSpec AS61302

LL-37, Antimicrobial Peptide, human[[LL-37, 37 aa]] ; MW 4493.3; (1 mg) Antimicrobial peptide LL-37,� belonging� to the cathelicidin family, �is the first amphipathic alpha-helical peptide isolated from human.��It plays�an important role in the first line of defense against local infection and systemic invasion of pathogens at sites of inflammation and wounds.��Cytotoxic to both bacterial and normal eukaryotic cells�, LL-37�is significantly resistant to proteolytic degradation in solution.�
The Fisher Scientific Encompass Program offers items which are not part of our distribution portfolio. These products typically do not have pictures or detailed descriptions. However, we are committed to improving your shopping experience. Please use the form below to provide feedback related to the content on this product.