Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. 502109892

CPC Scientific H-Ile-Leu-Gln-Arg-Gly-Ser-Gly-Thr-Ala-Ala-Val-Asp-Phe-Thr-Lys-Lys-Asp-His-Thr-Ala-Thr-Trp-Gly-Arg-Pro-Phe-Phe-Leu-Phe-Arg-Pro-Arg-Asn-NH2 (trifluoroacetate salt) 0.5MG
SDP

Supplier:  CPC Scientific NEUP007A

Encompass

This peptide was originally isolated from rat brain as an endogenous ligand for two orphan G protein-coupled receptors FM-3/GPR66 and FM-4/TGR-1, which have been identified as neuromedin U (NMU) receptors. hNMS-33 is specifically expressed in the suprachiasmatic nuclei (SCN) of the hypothalamus. It has been shown that NMS is implicated in the regulation of circadian rhythms through autocrine and/or paracrine actions.ONE-LETTER SEQUENCE: ILQRGSGTAAVDFTKKDHTATWGRPFFLFRPRN-NH2MOLECULAR FORMULA: C173H265N53O44MOLECULAR WEIGHT:3791.34STORAGE CONDITIONS: -20 5C, CAS REGISTRY NUMBER: [1138204-27-9], RESEARCH AREA: ObesityREFERENCES: K.Mori et al., EMBO J., 24, 325 (2005)

Catalog No. 50-210-9892


May include imposed supplier surcharges.
Only null left
Add to Cart

Product Content Correction

The Fisher Scientific Encompass Program offers items which are not part of our distribution portfolio. These products typically do not have pictures or detailed descriptions. However, we are committed to improving your shopping experience. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Your feedback has been submitted: Thank you for helping us improve our website.