Learn More
CPC Scientific H-Ile-Leu-Gln-Arg-Gly-Ser-Gly-Thr-Ala-Ala-Val-Asp-Phe-Thr-Lys-Lys-Asp-His-Thr-Ala-Thr-Trp-Gly-Arg-Pro-Phe-Phe-Leu-Phe-Arg-Pro-Arg-Asn-NH2 (trifluoroacetate salt) 0.5MG

Supplier: CPC Scientific NEUP007A
This peptide was originally isolated from rat brain as an endogenous ligand for two orphan G protein-coupled receptors FM-3/GPR66 and FM-4/TGR-1, which have been identified as neuromedin U (NMU) receptors. hNMS-33 is specifically expressed in the suprachiasmatic nuclei (SCN) of the hypothalamus. It has been shown that NMS is implicated in the regulation of circadian rhythms through autocrine and/or paracrine actions.ONE-LETTER SEQUENCE: ILQRGSGTAAVDFTKKDHTATWGRPFFLFRPRN-NH2MOLECULAR FORMULA: C173H265N53O44MOLECULAR WEIGHT:3791.34STORAGE CONDITIONS: -20 5C, CAS REGISTRY NUMBER: [1138204-27-9], RESEARCH AREA: ObesityREFERENCES: K.Mori et al., EMBO J., 24, 325 (2005)
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.