Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CPC Scientific H-Glu-Gln-Val-Thr-Asn-Val-Gly-Gly-Ala-Val-Val-Thr-Gly-Val-Thr-Ala-Val-Ala-Gln-Lys-Thr-Val-Glu-Gly-Ala-Gly-Ser-Ile-Ala-Ala-Ala-Thr-Gly-Phe-Val-OH (trifluoroacetate salt) 1MG
Supplier: CPC Scientific AMYD052B
This peptide was isolated from the insoluble core of Alzheimer's disease (AD) amyloid plaque. It is the fragment (61-95) of NACP or alpha-synuclein and forms amyloid fibrils via a nucleation-dependent polymerization mechanism. Accumulation of NAC aggregates in the synapse might be responsible for the neurodegeneration in AD and in the prion diseases.ONE-LETTER SEQUENCE: EQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVMOLECULAR FORMULA: C141H235N39O49MOLECULAR WEIGHT:3260.65STORAGE CONDITIONS: -20 5C, CAS REGISTRY NUMBER: [154040-19-4], RESEARCH AREA: Alzheimer's DiseaseREFERENCES: H.Han et al., Chemistry and Biology, 2, 163 (1995); A.Iwai et al., Biochemistry, 34, 10139 (1995
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?