Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CPC Scientific H-His-Ser-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Lys-Tyr-Leu-Asp-Ser-Arg-Arg-Ala-Gln-Asp-Phe-Val-Gln-Trp-Leu-Met-Asn-Thr-Lys-Arg-Asn-Arg-Asn-Asn-Ile-Ala-OH 0.5MG
Supplier: CPC Scientific GLUC015A
Oxyntomodulin is a potent inhibitor of gastric acid secretion and pancreatic enzyme secretion when infused iv. It was also proposed that intracerebroventricularly and into the hypothalamic paraventricular nucleus injected oxyntomodulin inhibits food intake in fasted and nonfasted animals potently and in a sustained manner.SEQUENCE: H-His-Ser-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Lys-Tyr-Leu-Asp-Ser-Arg-Arg-Ala-Gln-Asp-Phe-Val-Gln-Trp-Leu-Met-Asn-Thr-Lys-Arg-Asn-Arg-Asn-Asn-Ile-Ala-OHONE-LETTER SEQUENCE: HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIAMOLECULAR FORMULA: C192H295N61O60S1MOLECULAR WEIGHT: 4449.90STORAGE CONDITIONS: -20 5 CCAS REGISTRY NUMBER: [159002-68-3]SYNONYMS: Glucagon-37 (human, mouse, rat), Preproglucagon (53-89) (human, mouse, rat), OXM (human, mouse, rat), Proglucagon (33-69) (human, mouse, rat)RESEARCH AREA: DiabetesREFERENCES:C.L.Dakin et al., Endocrinology, 142, 4244 (2001)SKU(s): GLUC-015A, GLUC-015B
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?