Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CPC Scientific H-Ile-Lys-Pro-Glu-Ala-Pro-Gly-Glu-Asp-Ala-Ser-Pro-Glu-Glu-Leu-Asn-Arg-Tyr-Tyr-Ala-Ser-Leu-Arg-His-Tyr-Leu-Asn-Leu-Val-Thr-Arg-Gln-Arg-Tyr-NH2 (trifluoroacetate salt) 1MG
Supplier: CPC Scientific PEPY005B
Y2 receptor agonist, released from the body's gastrointestinal tract in proportion to caloric intake, that significantly decreases appetite and reduces food intake, and thus may act as a drug for the treatment of obesity. ONE-LETTER SEQUENCE: IKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2MOLECULAR FORMULA: C180H279N53O54MOLECULAR WEIGHT:4049.52STORAGE CONDITIONS: -20 5C, CAS REGISTRY NUMBER: [123583-37-9], SYNONYMS: PYY (3-36) (human)Peptide YY (3-36) (human)RESEARCH AREA: GastrointestinalREFERENCES: D. Grandt et al., Regulatory Peptides, 40, 161(1992)
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?