Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. 502110149

CPC Scientific H-Ile-Lys-Pro-Glu-Ala-Pro-Gly-Glu-Asp-Ala-Ser-Pro-Glu-Glu-Leu-Asn-Arg-Tyr-Tyr-Ala-Ser-Leu-Arg-His-Tyr-Leu-Asn-Leu-Val-Thr-Arg-Gln-Arg-Tyr-NH2 (trifluoroacetate salt) 1MG
SDP

Supplier:  CPC Scientific PEPY005B

Encompass

Y2 receptor agonist, released from the body's gastrointestinal tract in proportion to caloric intake, that significantly decreases appetite and reduces food intake, and thus may act as a drug for the treatment of obesity. ONE-LETTER SEQUENCE: IKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2MOLECULAR FORMULA: C180H279N53O54MOLECULAR WEIGHT:4049.52STORAGE CONDITIONS: -20 5C, CAS REGISTRY NUMBER: [123583-37-9], SYNONYMS: PYY (3-36) (human)Peptide YY (3-36) (human)RESEARCH AREA: GastrointestinalREFERENCES: D. Grandt et al., Regulatory Peptides, 40, 161(1992)

Catalog No. 50-211-0149


May include imposed supplier surcharges.
Only null left
Add to Cart

Product Content Correction

The Fisher Scientific Encompass Program offers items which are not part of our distribution portfolio. These products typically do not have pictures or detailed descriptions. However, we are committed to improving your shopping experience. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Your feedback has been submitted: Thank you for helping us improve our website.