Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

CPC Scientific H-Tyr-Pro-Ala-Lys-Pro-Glu-Ala-Pro-Gly-Glu-Asp-Ala-Ser-Pro-Glu-Glu-Leu-Ser-Arg-Tyr-Tyr-Ala-Ser-Leu-Arg-His-Tyr-Leu-Asn-Leu-Val-Thr-Arg-Gln-Arg-Tyr-NH2 (trifluoroacetate salt) 1MG
SDP

Supplier:  CPC Scientific PEPY004B

Encompass

ONE-LETTER SEQUENCE: YPAKPEAPGEDASPEELSRYYASLRHYLNLVTRQRY-NH2MOLECULAR FORMULA: C190H288N54O57MOLECULAR WEIGHT:4240.71STORAGE CONDITIONS: -20 5C, CAS REGISTRY NUMBER: [81858-94-8], SYNONYMS: PYY (canine, mouse, porcine, rat), Peptide YY (canine, mouse, porcine, rat)RESEARCH AREA: GastrointestinalREFERENCES: K. Tatemoto et al., Nature, 285, 417 (1980); R. Corder et al., Regulatory Peptides, 21, 253 (1988); K. Tatemoto, PNAS, 79, 2514 (1982)

Catalog No. 50-211-0147


May include imposed supplier surcharges.
Only null left
Add to Cart

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.