Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

CPC Scientific H-Ser-Arg-Thr-His-Arg-His-Ser-Met-Glu-Ile-Arg-Thr-Pro-Asp-Ile-Asn-Pro-Ala-Trp-Tyr-Ala-Ser-Arg-Gly-Ile-Arg-Pro-Val-Gly-Arg-Phe-NH2 0.5MG
SDP

Supplier:  CPC Scientific PROL001A

Encompass

Multifunctional Peptide in NeuroendocrinologySEQUENCE: H-Ser-Arg-Thr-His-Arg-His-Ser-Met-Glu-Ile-Arg-Thr-Pro-Asp-Ile-Asn-Pro-Ala-Trp-Tyr-Ala-Ser-Arg-Gly-Ile-Arg-Pro-Val-Gly-Arg-Phe-NH2ONE-LETTER SEQUENCE: SRTHRHSMEIRTPDINPAWYASRGIRPVGRF-NH2MOLECULAR FORMULA: C160H252N56O42S1MOLECULAR WEIGHT: 3664.2STORAGE CONDITIONS: -20 5 CCAS REGISTRY NUMBER: [215510-22-8]SYNONYMS: PrRP31 (human), Preprolactin (23-53) (human), Prolactin-Releasing Peptide (1-31) (human)RESEARCH AREA: HormonalREFERENCES:Engstr?m, et al. J. Pharmacol. Exp. Ther. 305, 825 (2003) S. Hinuma, et al. Nature, 393, 272 (1998) F. Satoh, et. al. J. Pharmacol.,129, 1787 (2000)

SKU(s): PROL-001A, PROL-001B

Catalog No. 50-211-0327


May include imposed supplier surcharges.
Only null left
Add to Cart

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.