Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. 502108683

CPC Scientific TAMRA-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-OH (trifluoroacetate salt) 0.5MG
SDP

Supplier:  CPC Scientific AMYD027B

Encompass

Synthetic peptide that forms fibrils with have the same antigenic and structural features as those of native AD amyloid filaments.ONE-LETTER SEQUENCE: TAMRA-DAEFRHDSGYEVHHQKLVFFAEDVGSNKMOLECULAR FORMULA: C170H230N43O50MOLECULAR WEIGHT:3676STORAGE CONDITIONS: -20 5C, CAS REGISTRY NUMBER: [109770-29-8], RESEARCH AREA: Alzheimer's DiseaseREFERENCES: J. Kang et al., Nature, 325, 773 (1987)

Catalog No. 50-210-8683


May include imposed supplier surcharges.
Only null left
Add to Cart

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.