Learn More
CPC Scientific TAMRA-Ser-Pro-Lys-Met-Val-Gln-Gly-Ser-Gly-Cys-Phe-Gly-Arg-Lys-Met-Asp-Arg-Ile-Ser-Ser-Ser-Ser-Gly-Leu-Gly-Cys-Lys-Val-Leu-Arg-Arg-His-OH (trifluoroacetate salt) 0.5MG

Supplier: CPC Scientific NATR011A
Brain natriuretic peptide or B-type natriuretic peptide (BNP) (also ventricular natriuretic peptide) is a 32-amino acid peptide secreted by heart ventricles in response to excessive stretching of heart muscle cells (cardiomyocytes).ONE-LETTER SEQUENCE: TAMRA-SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH (Cys10 and 26 bridge)MOLECULAR FORMULA: C168H266N52O46S4MOLECULAR WEIGHT:3878.6STORAGE CONDITIONS: -20 5C, CAS REGISTRY NUMBER: [114471-18-0], RESEARCH AREA: CardiovascularREFERENCES: T. Sudoh et al., BBRC, 159, 1427 (1989)
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.