Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. 502110594

CPC Scientific H-Val-Ile-Leu-Ser-Leu-Asp-Val-Pro-Ile-Gly-Leu-Leu-Arg-Ile-Leu-Leu-Glu-Gln-Ala-Arg-Tyr-Lys-Ala-Ala-Arg-Asn-Gln-Ala-Ala-Thr-Asn-Ala-Gln-Ile-Leu-Ala-His-Val-NH2 (trifluoroacetate salt) 0.5MG
SDP

Supplier:  CPC Scientific UROC005A

Encompass

This peptide has exhibited considerably higher affinity for both splice variants of the type 2 CRF receptor (CRF-R2) than for those of CRF-R1. The potencies of Ucn II (mouse) in activating CRF-R2a and CRF-R2b were almost the same to that of urocortin (rat).ONE-LETTER SEQUENCE: VILSLDVPIGLLRILLEQARYKAARNQAATNAQILAHV-NH2MOLECULAR FORMULA: C187H320N56O50MOLECULAR WEIGHT:4153STORAGE CONDITIONS: -20 5C, CAS REGISTRY NUMBER: [330648-32-3], RESEARCH AREA: NeuropeptidesREFERENCES: K.Lewis et al., Proc. Natl. Acad. Sci. USA , 98, 7570 (2001); S.Y.Hsu et al., Nature Medicine 7, 605 (2001); T.M.Reyes et al., Proc. Natl. Acad. Sci. USA , 98, 2843 (2001)

Catalog No. 50-211-0594


May include imposed supplier surcharges.
Only null left
Add to Cart

Product Content Correction

The Fisher Scientific Encompass Program offers items which are not part of our distribution portfolio. These products typically do not have pictures or detailed descriptions. However, we are committed to improving your shopping experience. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Your feedback has been submitted: Thank you for helping us improve our website.