Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CPC Scientific H-Val-Ile-Leu-Ser-Leu-Asp-Val-Pro-Ile-Gly-Leu-Leu-Arg-Ile-Leu-Leu-Glu-Gln-Ala-Arg-Tyr-Lys-Ala-Ala-Arg-Asn-Gln-Ala-Ala-Thr-Asn-Ala-Gln-Ile-Leu-Ala-His-Val-NH2 (trifluoroacetate salt) 0.5MG
Supplier: CPC Scientific UROC005A
This peptide has exhibited considerably higher affinity for both splice variants of the type 2 CRF receptor (CRF-R2) than for those of CRF-R1. The potencies of Ucn II (mouse) in activating CRF-R2a and CRF-R2b were almost the same to that of urocortin (rat).ONE-LETTER SEQUENCE: VILSLDVPIGLLRILLEQARYKAARNQAATNAQILAHV-NH2MOLECULAR FORMULA: C187H320N56O50MOLECULAR WEIGHT:4153STORAGE CONDITIONS: -20 5C, CAS REGISTRY NUMBER: [330648-32-3], RESEARCH AREA: NeuropeptidesREFERENCES: K.Lewis et al., Proc. Natl. Acad. Sci. USA , 98, 7570 (2001); S.Y.Hsu et al., Nature Medicine 7, 605 (2001); T.M.Reyes et al., Proc. Natl. Acad. Sci. USA , 98, 2843 (2001)
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?