Recombinant Proteins

Modified or manipulated proteins encoded by recombinant DNA and suitable for a variety of purposes including the modification of gene sequences, mass protein production, and the manufacture of commercial products.

3,871 – 3,885 of 115,737 results

3,871

Novus Biologicals™ Recombinant Human PIM2 His Protein

Highly purified. Generating reliable and reproducible results.

Pricing & Availability
Specifications

Purity or Quality Grade	>85%, by SDS-PAGE
Conjugate	Unconjugated
Gene Alias	EC 2.7.11.1, pim-2 oncogene, pim-2h, proto-oncogene Pim-2 (serine threonine kinase), serine/threonine protein kinase pim-2, serine/threonine-protein kinase pim-2
Common Name	PIM2
Molecular Weight (g/mol)	TMW: 36.6kDa
Gene ID (Entrez)	11040
Formulation	20mM Tris-HCl buffer (pH 8.0) containing 0.1M NaCl, 10% glycerol
Storage Requirements	Store at 4°C short term. Aliquot and store at −20°C long term. Avoid freeze-thaw cycles.
Concentration	0.25mg/mL
For Use With (Application)	SDS-PAGE
Recombinant	Recombinant

3,872

R&D Systems™ Recombinant Human PRL-3/PTP4A3 Protein

Extensive quality control produces industry leading bioactivity and lot-to-lot consistency that instills confidence in results and ensures reproducibility.

Pricing & Availability

3,873

Novus Biologicals™ mtTFA Protein

Highly purified. Generating reliable and reproducible results.

Pricing & Availability
Specifications

Regulatory Status	RUO
Purification Method	SDS-PAGE
Purity or Quality Grade	>85%
Conjugate	Unconjugated
Common Name	mtTFA
Molecular Weight (g/mol)	26.6kDa
Formulation	Liquid. In 20mM Tris-HCl buffer (pH 8.0) containing 0.2M NaCl, 5mM DTT, 20% glycerol
Storage Requirements	Store at -80°C. Avoid freeze-thaw cycles.
Concentration	0.25mg/mL
For Use With (Application)	SDS-PAGE

3,874

R&D Systems™ Recombinant Mouse SLAM/CD150 Protein

Extensive quality control produces industry leading bioactivity and lot-to-lot consistency that instills confidence in results and ensures reproducibility.

Pricing & Availability

3,875

Novus Biologicals™ Recombinant Human CD30/TNFRSF8 His Protein

Highly purified. Generating reliable and reproducible results. Applications: SDS-Page

Pricing & Availability
Specifications

Purity or Quality Grade	>95%, by SDS-PAGE under reducing conditions and visualized by Colloidal Coomassie™ Blue stain
Conjugate	Unconjugated
Gene Alias	CD30, CD30 antigen, CD30KI-1, CD30L receptor, cytokine receptor CD30, D1S166EKi-1, Ki-1 antigen, Lymphocyte activation antigen CD30, tumor necrosis factor receptor superfamily member 8, tumor necrosis factor receptor superfamily, member 8
Common Name	CD30/TNFRSF8
Molecular Weight (g/mol)	TMW: 39.5kDa
Gene ID (Entrez)	943
Formulation	Phosphate buffered saline (pH 7.4) containing 10% glycerol
Storage Requirements	Store at 4°C short term. Aliquot and store at −20°C long term. Avoid freeze-thaw cycles.
Concentration	1mg/mL
For Use With (Application)	SDS-PAGE
Source	Baculovirus
Recombinant	Recombinant

3,876

R&D Systems™ Recombinant Human CD200 His-tag Avi-tag Protein

Biotinylated

Pricing & Availability

3,877

R&D Systems™ Recombinant SARS-CoV-2 Spike RBD Fc Chimera Protein

Sf21 Expressed, High ACE-2 Binding

Pricing & Availability

3,878

R&D Systems™ Recombinant Human IL-3 Protein

Extensive quality control produces industry leading bioactivity and lot-to-lot consistency that instills confidence in results and ensures reproducibility. Applications: Bioactivity

Pricing & Availability
Specifications

Accession Number	AAC08706
Purity or Quality Grade	97%, by SDS-PAGE under reducing conditions and visualized by silver stain.
Conjugate	Unconjugated
Gene Alias	Hematopoietic growth factor, IL3, IL-3MGC79398, interleukin 3 (colony-stimulating factor, multiple), interleukin-3, Mast cell growth factor, mast-cell growth factor, MCGF, MCGFMGC79399, MULTI-CSF, multilineage-colony-stimulating factor, Multipotential colony-stimulating factor, P-cell stimulating factor, P-cell-stimulating factor
Molecular Weight (g/mol)	15 kDa
Gene ID (Entrez)	3562
Storage Requirements	Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70° C as supplied. 1 month, 2 to 8° C under sterile conditions after reconstitution. 3 months, -20 to -70° C under sterile conditions after reconstitution.
Source	E. coli-derived human IL-3 protein Ala20-Phe152,with and without an N-terminal Met
Recombinant	Recombinant
Name	IL-3

3,879

Novus Biologicals™ LYPLA1 Protein

Highly purified. Generating reliable and reproducible results.

Pricing & Availability
Specifications

Regulatory Status	RUO
Purification Method	Protein
Purity or Quality Grade	>90%
Conjugate	Unconjugated
Common Name	LYPLA1
Molecular Weight (g/mol)	26.8kDa
Gene ID (Entrez)	10434
Formulation	Liquid. 20mM Tris-HCl buffer (pH 8.0) containing 10% glycerol 0.1M NaCl, 1mM DTT
Immunogen	LYPLA1, 1-230 aa. Sequence: MGSSHHHHHHSSGLVPRGSHMCGNNMSAPMPAVVPAARKATAAVIFLHGLGDTGHGWAEAFAGIKSPHIKYICPHAPVMPVTLNMNMAMPSWFDIVGLSPDSQEDESGIKQAAETVKALIDQEVKNGIPSNRIILGGFSQGGALSLYTALTTQQKLAGVTALSCWLPLRASFSQGPINSANRDISVLQCHGDCDPLVPLMFGSLTVERLKALINPANVTFKIYEGMMHSSCQQEMMDVKHFIDKLLPPID
Storage Requirements	Store at -80°C. Avoid freeze-thaw cycles.
Concentration	0.5mg/mL
For Use With (Application)	ELISA,SDS-PAGE
Source	Human

3,880

Novus Biologicals™ Recombinant Human NUP62CL His Protein

Highly purified. Generating reliable and reproducible results. Applications: SDS-Page

Pricing & Availability
Specifications

Purity or Quality Grade	>80%, by SDS-PAGE under reducing conditions and visualized by Colloidal Coomassie™ Blue stain
Conjugate	Unconjugated
Gene Alias	FLJ20130, nucleoporin 62kDa C-terminal like, nucleoporin-62 C-terminal-like protein, NUP62L
Common Name	NUP62CL
Molecular Weight (g/mol)	TMW: 10.3kDa
Gene ID (Entrez)	54830
Formulation	20mM Tris-HCl buffer (pH 8.0) containing 10% glycerol, 0.4M UREA
Storage Requirements	Store at 4°C short term. Aliquot and store at −20°C long term. Avoid freeze-thaw cycles.
Concentration	1mg/mL
For Use With (Application)	SDS-PAGE
Recombinant	Recombinant

3,881

R&D Systems™ Recombinant Human IL1RAPL1 Protein

Extensive quality control produces industry leading bioactivity and lot-to-lot consistency that instills confidence in results and ensures reproducibility.

Pricing & Availability

3,882

R&D Systems™ Recombinant Human Sonic Hedgehog/Shh (C24II) Animal-Free

Also available, GMP Shh Protein, Catalog # 1845-GMP! Animal-free and manufactured under GMP guidelines for therapeutic manufacturing applications.

Pricing & Availability
Specifications

Accession Number	NP_000184.1
Purity or Quality Grade	>95%, by SDS-PAGE under reducing conditions and visualized by silver stain.
Conjugate	Unconjugated
Gene Alias	HHG1, HHG-1, HLP3, HPE3, MCOPCB5, MCOPCB5sonic hedgehog (Drosophila) homolog, Shh, ShhNC, SMMCI, SMMCIsonic hedgehog homolog (Drosophila), sonic hedgehog, sonic hedgehog homolog, sonic hedgehog protein, TPT, TPTPS
Molecular Weight (g/mol)	M.W.-observed: 22 kDa, reducing conditions, M.W.-theroretical: 20 kDa
Gene ID (Entrez)	6469
Formulation	Lyophilized from a 0.2 μm filtered solution in PBS and NaCl.
Reconstitution	Reconstitute at 100-200 μg/mL in PBS, and allow up to 24 hours (at 2°C to 8°C for complete reconstitution.)
Endotoxin Concentration	<0.01 EU / 1 μg of the protein by the LAL method.
Storage Requirements	Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20°C to -70°C as supplied. 1 month, 2°C to 8°C under sterile conditions after reconstitution. 3 months, -20°C to -70°C under sterile conditions after reconstitution.
For Use With (Application)	Bioactivity
Protein	Sonic Hedgehog/Shh
Source	E. coli-derived human Sonic Hedgehog/Shh protein Cys24-Gly197 (Cys24Ile-Ile), with an N-terminal Met Produced using non-animal reagents in an animal-free laboratory.

3,883

Novus Biologicals™ Septin-5 Protein

Highly purified. Generating reliable and reproducible results.

Pricing & Availability

3,884

Invitrogen™ Human IFN-omega Recombinant Protein

Recombinant Protein

Pricing & Availability
Specifications

Regulatory Status	RUO
Purity or Quality Grade	>95%
Conjugate	Unconjugated
Form	Liquid
Molecular Weight (g/mol)	20 kDa
Formulation	PBS with 2% BSA and no preservative
Endotoxin Concentration	<1 EU/ μg
Concentration	Lot-specific
For Use With (Application)	ELISA,Immunoprecipitation,Western Blot
Source	E. Coli
Name	Human IFN-omega
Recombinant	Recombinant

3,885

Novus Biologicals™ Recombinant Human SOCS-3 His Protein

Highly purified. Generating reliable and reproducible results. Applications: SDS-Page

Pricing & Availability
Specifications

Purity or Quality Grade	>90%, by SDS-PAGE under reducing conditions and visualized by Colloidal Coomassie™ Blue stain
Conjugate	Unconjugated
Gene Alias	CIS3CIS-3, Cish3, cytokine-induced SH2 protein 3, Cytokine-inducible SH2 protein 3, SOCS-3STAT-induced STAT inhibitor 3, SSI-3ATOD4, SSI3MGC71791, suppressor of cytokine signaling 3
Common Name	SOCS-3
Molecular Weight (g/mol)	TMW: 29kDa
Gene ID (Entrez)	9021
Formulation	20mM Tris-HCl buffer (pH 8.0) containing 0.4M UREA, 10% glycerol
Storage Requirements	Store at 4°C short term. Aliquot and store at −20°C long term. Avoid freeze-thaw cycles.
Concentration	0.5mg/mL
For Use With (Application)	SDS-PAGE
Recombinant	Recombinant

Prev
1
...
257
258
259
260
...
7,716
Next

Welcome to fishersci.com

Recombinant Proteins

Filtered Search Results

Narrow Results

Novus Biologicals™ Recombinant Human PIM2 His Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ mtTFA Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ Recombinant Human CD30/TNFRSF8 His Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

R&D Systems™ Recombinant Human IL-3 Protein GSA/VA ContractAvailable on GSA/VA contract for Federal Government customers.Learn More

Novus Biologicals™ LYPLA1 Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ Recombinant Human NUP62CL His Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ Septin-5 Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ Recombinant Human SOCS-3 His Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ Recombinant Human PIM2 His Protein

Novus Biologicals™ mtTFA Protein

Novus Biologicals™ Recombinant Human CD30/TNFRSF8 His Protein

R&D Systems™ Recombinant Human IL-3 Protein

Novus Biologicals™ LYPLA1 Protein

Novus Biologicals™ Recombinant Human NUP62CL His Protein

Novus Biologicals™ Septin-5 Protein

Novus Biologicals™ Recombinant Human SOCS-3 His Protein